Signal peptide peptidase-like 2B Antibody Summary
Immunogen |
Synthetic peptides corresponding to SPPL2B(signal peptide peptidase-like 2B) The peptide sequence was selected from the N terminal of SPPL2B.
Peptide sequence VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SPPL2B |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:100-1:2000
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
|
Application Notes |
This is a rabbit polyclonal antibody against SPPL2B and was validated on Western Blot and immunohistochemistry-paraffin |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Signal peptide peptidase-like 2B Antibody
Background
SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, IHC, IHC-P
Publications for Signal peptide peptidase-like 2B Antibody (NBP1-59510) (0)
There are no publications for Signal peptide peptidase-like 2B Antibody (NBP1-59510).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Signal peptide peptidase-like 2B Antibody (NBP1-59510) (0)
There are no reviews for Signal peptide peptidase-like 2B Antibody (NBP1-59510).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Signal peptide peptidase-like 2B Antibody (NBP1-59510) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional Signal peptide peptidase-like 2B Products
Bioinformatics Tool for Signal peptide peptidase-like 2B Antibody (NBP1-59510)
Discover related pathways, diseases and genes to Signal peptide peptidase-like 2B Antibody (NBP1-59510). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Signal peptide peptidase-like 2B Antibody (NBP1-59510)
Discover more about diseases related to Signal peptide peptidase-like 2B Antibody (NBP1-59510).
| | Pathways for Signal peptide peptidase-like 2B Antibody (NBP1-59510)
View related products by pathway.
|
PTMs for Signal peptide peptidase-like 2B Antibody (NBP1-59510)
Learn more about PTMs related to Signal peptide peptidase-like 2B Antibody (NBP1-59510).
|
Blogs on Signal peptide peptidase-like 2B