Signal peptide peptidase-like 2B Antibody

Western Blot: Signal peptide peptidase-like 2B Antibody [NBP1-59510] - Jurkat cell lysate, concentration 1 ug/ml.

Immunohistochemistry-Paraffin: Signal peptide peptidase-like 2B Antibody [NBP1-59510] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Signal peptide peptidase-like 2B Antibody Summary

• Immunogen: Synthetic peptides corresponding to SPPL2B(signal peptide peptidase-like 2B) The peptide sequence was selected from the N terminal of SPPL2B. Peptide sequence VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPPL2B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against SPPL2B and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Signal peptide peptidase-like 2B Antibody

• EC 3.4.23
• EC 3.4.23.-
• IMP-4
• IMP4MGC111084
• Intramembrane protease 4
• KIAA1532signal peptide peptidase-like 2B
• Presenilin-like protein 1
• PSL1
• SNPPL2B
• SPPL2b
• SPP-like 2B

Background

SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPPL2B
• Uniprot:
  • Q8TCT7-4(Human)