Signal peptide peptidase-like 2B Antibody

Images

 
Western Blot: Signal peptide peptidase-like 2B Antibody [NBP1-59510] - Jurkat cell lysate, concentration 1 ug/ml.
Immunohistochemistry-Paraffin: Signal peptide peptidase-like 2B Antibody [NBP1-59510] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Signal peptide peptidase-like 2B Antibody Summary

Immunogen
Synthetic peptides corresponding to SPPL2B(signal peptide peptidase-like 2B) The peptide sequence was selected from the N terminal of SPPL2B. Peptide sequence VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPPL2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SPPL2B and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Signal peptide peptidase-like 2B Antibody

  • EC 3.4.23
  • EC 3.4.23.-
  • IMP-4
  • IMP4MGC111084
  • Intramembrane protease 4
  • KIAA1532signal peptide peptidase-like 2B
  • Presenilin-like protein 1
  • PSL1
  • SNPPL2B
  • SPPL2b
  • SPP-like 2B

Background

SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87512
Species: Hu
Applications: IHC, IHC-P
NBP1-84339
Species: Hu
Applications: WB, IHC, IHC-P
H00081502-P01
Species: Hu
Applications: WB
NBP1-36963
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-84341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-75542
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-02627
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF7028
Species: Mu, Rt
Applications: WB, ICC
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-89957
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Signal peptide peptidase-like 2B Antibody (NBP1-59510) (0)

There are no publications for Signal peptide peptidase-like 2B Antibody (NBP1-59510).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Signal peptide peptidase-like 2B Antibody (NBP1-59510) (0)

There are no reviews for Signal peptide peptidase-like 2B Antibody (NBP1-59510). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Signal peptide peptidase-like 2B Antibody (NBP1-59510) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Signal peptide peptidase-like 2B Products

Bioinformatics Tool for Signal peptide peptidase-like 2B Antibody (NBP1-59510)

Discover related pathways, diseases and genes to Signal peptide peptidase-like 2B Antibody (NBP1-59510). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Signal peptide peptidase-like 2B Antibody (NBP1-59510)

Discover more about diseases related to Signal peptide peptidase-like 2B Antibody (NBP1-59510).
 

Pathways for Signal peptide peptidase-like 2B Antibody (NBP1-59510)

View related products by pathway.

PTMs for Signal peptide peptidase-like 2B Antibody (NBP1-59510)

Learn more about PTMs related to Signal peptide peptidase-like 2B Antibody (NBP1-59510).

Blogs on Signal peptide peptidase-like 2B

There are no specific blogs for Signal peptide peptidase-like 2B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Signal peptide peptidase-like 2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPPL2B
Uniprot