Recombinant Human Sigma-1 R/OPRS1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human Sigma-1 R/OPRS1 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-223 of Human OPRS1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: SIGMAR1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 51.5 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Sigma-1 R/OPRS1 GST (N-Term) Protein

• Aging-associated gene 8 protein
• ALS16
• FLJ25585
• hSigmaR1
• OPRS1
• SIG-1R
• sigma 1
• Sigma 1-type opioid receptor
• sigma non-opioid intracellular receptor 1
• Sigma-1 R
• sigma1 receptor
• Sigma1R
• Sigma-1R
• sigma1-receptor
• SIGMAR1
• SR31747 binding protein 1
• SR31747-binding protein
• SRBP
• SR-BP
• SR-BP1
• SRBPMGC3851
• type I sigma receptor

Background

This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. Alternative splicing of this gene results in transcript variants encoding distinct isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Sigma-1 R/OPRS1 Recombinant Protein (H00010280-P01)(1)

Publication using H00010280-P01

• Moon JY, Roh DH, Yoon SY et al. sigma-1s activate astrocytes via p38 MAPK phosphorylation leading to the development of mechanical allodynia in a mouse model of neuropathic pain. Br. J Pharmacol. 2014-08-27 [PMID: 25158784]

Bioinformatics

• Gene Symbol: SIGMAR1