Siglec-10 Antibody - BSA Free

Western Blot: SIGLEC10 Antibody [NBP1-59247] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Siglec-10 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SIGLEC10(sialic acid binding Ig-like lectin 10) The peptide sequence was selected from the middle region of SIGLEC10. Peptide sequence CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIGLEC10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Siglec-10 Antibody - BSA Free

• MGC126774
• PRO940
• sialic acid binding Ig-like lectin 10
• sialic acid-binding Ig-like lectin 10
• Siglec10
• Siglec-10
• siglec-like gene 2
• Siglec-like protein 2
• SLG2
• SLG2sialic acid binding Ig-like lectin 10 Ig-like lectin 7

Background

SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. SIGLEC10 preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, SIGLEC10 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.SIGLECs are members of the immunoglobulin superfamily that are expressed on the cell surface. Most SIGLECs have 1 or more cytoplasmic immune receptor tyrosine-based inhibitory motifs, or ITIMs. SIGLECs are typically expressed on cells of the innate immune system, with the exception of the B-cell expressed SIGLEC6 (MIM 604405).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-653 AC008750.9 90495-91147 c 654-760 DA387605.1 391-497 761-2959 AF301007.1 262-2460 2960-3794 AY358337.1 1930-2764

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SIGLEC10
• Uniprot:
  • Q96LC7()