SIAH3 Antibody

Images

 
Immunohistochemistry-Paraffin: SIAH3 Antibody [NBP2-32555] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SIAH3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEAGLHANPVTPCLCMCPLFSCQWEGRLEVVVPHLRQIHRVDILQGAEIVFLATDMHLPAPADWIIMHS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SIAH3 Protein (NBP2-32555PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SIAH3 Antibody

  • Seven In Absentia Homolog 3 (Drosophila)
  • Seven In Absentia Homolog 3
  • Siah E3 Ubiquitin Protein Ligase Family Member 3
  • siah-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

23320002
Species: Hu
Applications: ELISA, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF4737
Species: Hu
Applications: WB
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
AF6817
Species: Hu
Applications: WB
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
MAB2476
Species: Hu
Applications: WB, IHC
44450002
Species: Hu
Applications: WB, ELISA
NB100-41371
Species: Hu, Mu, Rt, Ma
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84492
Species: Hu
Applications: IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-60414
Species: Hu
Applications: WB, IP
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32555
Species: Hu
Applications: IHC, IHC-P

Publications for SIAH3 Antibody (NBP2-32555) (0)

There are no publications for SIAH3 Antibody (NBP2-32555).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIAH3 Antibody (NBP2-32555) (0)

There are no reviews for SIAH3 Antibody (NBP2-32555). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SIAH3 Antibody (NBP2-32555) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SIAH3 Products

SIAH3 NBP2-32555

Diseases for SIAH3 Antibody (NBP2-32555)

Discover more about diseases related to SIAH3 Antibody (NBP2-32555).

Blogs on SIAH3

There are no specific blogs for SIAH3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIAH3 Antibody and receive a gift card or discount.