SIAE Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 270-450 of human SIAE (NP_733746.1). LKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SIAE |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for SIAE Antibody - Azide and BSA Free
Background
Sialic acids are acidic 9-carbon sugars typically found at the nonreducing end of sugar chains. They are frequently modified by 9-O-acetylation, and this modification is removed by sialic acid acetylesterases. SIAE appears to encode both lysosomal and cytosolic sialic acid acetylesterase isoforms (LSE and CSE, respectively) (Takematsu et al., 1999 [PubMed 10464298]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Bv, Hu, Rt
Applications: DB, ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for SIAE Antibody (NBP2-93817) (0)
There are no publications for SIAE Antibody (NBP2-93817).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SIAE Antibody (NBP2-93817) (0)
There are no reviews for SIAE Antibody (NBP2-93817).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SIAE Antibody (NBP2-93817) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SIAE Products
Blogs on SIAE