SIAE Antibody - BSA Free

Immunohistochemistry-Paraffin: SIAE Antibody [NBP1-84372] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Analysis in human cell line CAPAN-2.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SIAE Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SIAE Antibody - BSA Free (NBP1-84372) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLN
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIAE
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SIAE Protein (NBP1-84372PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SIAE Antibody - BSA Free

• AIS6
• CSEC
• CSE-C
• cytosolic sialic acid 9-O-acetylesterase homolog
• EC 3.1.1.53
• H-Lse
• LSE
• MGC87009
• sialate O-acetylesterase
• sialic acid acetylesterase
• Sialic acid-specific 9-O-acetylesterase
• sialic acid-specific acetylesterase II
• Ysg2 homolog (mouse)
• YSG2

Background

Sialic acids are acidic 9-carbon sugars typically found at the nonreducing end of sugar chains. They are frequently modified by 9-O-acetylation, and this modification is removed by sialic acid acetylesterases. SIAE appears to encode both lysosomal and cytosolic sialic acid acetylesterase isoforms (LSE and CSE, respectively) (Takematsu et al., 1999 [PubMed 10464298]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SIAE