SIAE Antibody

Images

 
Immunohistochemistry-Paraffin: SIAE Antibody [NBP1-84372] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SIAE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIAE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SIAE Protein (NBP1-84372PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SIAE Antibody

  • AIS6
  • CSEC
  • CSE-C
  • cytosolic sialic acid 9-O-acetylesterase homolog
  • EC 3.1.1.53
  • H-Lse
  • LSE
  • MGC87009
  • sialate O-acetylesterase
  • sialic acid acetylesterase
  • Sialic acid-specific 9-O-acetylesterase
  • sialic acid-specific acetylesterase II
  • Ysg2 homolog (mouse)
  • YSG2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-37458
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB5657
Species: Hu
Applications: WB, IP, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
AF2009
Species: Hu
Applications: WB, IHC
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF7895
Species: Hu
Applications: WB, IHC
NB110-89459
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-84372
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for SIAE Antibody (NBP1-84372) (0)

There are no publications for SIAE Antibody (NBP1-84372).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIAE Antibody (NBP1-84372) (0)

There are no reviews for SIAE Antibody (NBP1-84372). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SIAE Antibody (NBP1-84372) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SIAE Products

Bioinformatics Tool for SIAE Antibody (NBP1-84372)

Discover related pathways, diseases and genes to SIAE Antibody (NBP1-84372). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIAE Antibody (NBP1-84372)

Discover more about diseases related to SIAE Antibody (NBP1-84372).
 

Pathways for SIAE Antibody (NBP1-84372)

View related products by pathway.

PTMs for SIAE Antibody (NBP1-84372)

Learn more about PTMs related to SIAE Antibody (NBP1-84372).

Blogs on SIAE

There are no specific blogs for SIAE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIAE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIAE