SHP-1 Antibody (7I1K3)

Images

 
Western Blot: SHP-1 Antibody (7I1K3) [NBP3-15669] - Western blot analysis of extracts of Raji cells, using SHP-1 antibody (NBP3-15669) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunohistochemistry: SHP-1 Antibody (7I1K3) [NBP3-15669] - Immunofluorescence analysis of mouse spleen using SHP-1 Rabbit mAb (NBP3-15669) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: SHP-1 Antibody (7I1K3) [NBP3-15669] - Western blot analysis of extracts of various cell lines, using SHP-1 antibody (NBP3-15669) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at ...read more
Immunohistochemistry-Paraffin: SHP-1 Antibody (7I1K3) [NBP3-15669] - Immunohistochemistry of paraffin-embedded rat spleen using SHP-1 Rabbit mAb (NBP3-15669) at dilution of 1:100 (40x lens).Perform microwave antigen ...read more
Immunohistochemistry-Paraffin: SHP-1 Antibody (7I1K3) [NBP3-15669] - Immunohistochemistry of paraffin-embedded human appendix using SHP-1 Rabbit mAb (NBP3-15669) at dilution of 1:100 (40x lens).Perform microwave antigen ...read more
Immunohistochemistry-Paraffin: SHP-1 Antibody (7I1K3) [NBP3-15669] - Immunohistochemistry of paraffin-embedded mouse spleen using SHP-1 Rabbit mAb (NBP3-15669) at dilution of 1:100 (40x lens).Perform microwave antigen ...read more
Immunohistochemistry: SHP-1 Antibody (7I1K3) [NBP3-15669] - Immunofluorescence analysis of rat spleen using SHP-1 Rabbit mAb (NBP3-15669) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
7I1K3
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHP-1 Antibody (7I1K3) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 496-595 of human SHP-1 (P29350). SGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
PTPN6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SHP-1 Antibody (7I1K3)

  • HCP
  • HCPH
  • HPTP1C
  • PTP1C
  • PTP-1C
  • PTPN6
  • SHP1
  • SHP-1
  • SHP-1L
  • SH-PTP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3790
Species: Hu, Mu
Applications: ICC, Simple Western, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
MAB7475
Species: Hu, Rt
Applications: WB
MAB4937
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
H00005250-B02P
Species: Hu
Applications: ICC/IF, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-46125
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
AF3846
Species: Hu, Mu, Rt
Applications: IHC, WB
NLS5411
Species: Ha, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
NBP3-16226
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-15669
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for SHP-1 Antibody (NBP3-15669) (0)

There are no publications for SHP-1 Antibody (NBP3-15669).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHP-1 Antibody (NBP3-15669) (0)

There are no reviews for SHP-1 Antibody (NBP3-15669). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SHP-1 Antibody (NBP3-15669) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHP-1 Products

Diseases for SHP-1 Antibody (NBP3-15669)

Discover more about diseases related to SHP-1 Antibody (NBP3-15669).
 

Pathways for SHP-1 Antibody (NBP3-15669)

View related products by pathway.

PTMs for SHP-1 Antibody (NBP3-15669)

Learn more about PTMs related to SHP-1 Antibody (NBP3-15669).
 

Research Areas for SHP-1 Antibody (NBP3-15669)

Find related products by research area.

Blogs on SHP-1

There are no specific blogs for SHP-1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHP-1 Antibody (7I1K3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPN6