SHOX2 Antibody

Images

 
Western Blot: SHOX2 Antibody [NBP2-86807] - WB Suggested Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHOX2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SHOX2. Peptide sequence: SEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPYVNVGALR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SHOX2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for SHOX2 Antibody

  • Homeobox protein Og12X
  • OG12SHOX homologous gene on chromosome 3
  • OG12Xshort stature homeobox protein 2
  • short stature homeobox 2
  • SHOTPaired-related homeobox protein SHOT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15753
Species: Hu, Mu, Rt
Applications: WB
H00023499-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
AF2444
Species: Hu
Applications: IHC, WB
AF7388
Species: Hu
Applications: IHC
314-BP/CF
Species: Hu
Applications: BA, BA
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: IHC, WB
NBP1-84020
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-525
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP1-92334
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-94461
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-90010
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-17099
Species: Hu
Applications: ELISA, IF, IHC, IHC-P, WB
NBP2-00714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF1404
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
345-FG/CF
Species: Hu
Applications: BA
NBP2-86807
Species: Hu
Applications: WB

Publications for SHOX2 Antibody (NBP2-86807) (0)

There are no publications for SHOX2 Antibody (NBP2-86807).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHOX2 Antibody (NBP2-86807) (0)

There are no reviews for SHOX2 Antibody (NBP2-86807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SHOX2 Antibody (NBP2-86807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHOX2 Products

Bioinformatics Tool for SHOX2 Antibody (NBP2-86807)

Discover related pathways, diseases and genes to SHOX2 Antibody (NBP2-86807). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHOX2 Antibody (NBP2-86807)

Discover more about diseases related to SHOX2 Antibody (NBP2-86807).
 

Pathways for SHOX2 Antibody (NBP2-86807)

View related products by pathway.

PTMs for SHOX2 Antibody (NBP2-86807)

Learn more about PTMs related to SHOX2 Antibody (NBP2-86807).

Blogs on SHOX2

There are no specific blogs for SHOX2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHOX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHOX2