SHIP Antibody - BSA Free

Western Blot: SHIP Antibody [NBP2-49633] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue

Immunocytochemistry/Immunofluorescence: SHIP Antibody [NBP2-49633] - Staining of human cell line Hep G2 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry: SHIP Antibody [NBP2-49633] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SHIP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SHIP Antibody - BSA Free (NBP2-49633) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPAPRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INPP5D
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SHIP Recombinant Protein Antigen (NBP2-49633PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SHIP Antibody - BSA Free

• 145kD
• EC 3.1.3
• hp51CNMGC142142
• Inositol polyphosphate-5-phosphatase of 145 kDa
• inositol polyphosphate-5-phosphatase, 145kDa
• INPP5D
• MGC104855
• SHIP
• SHIPMGC142140

Background

SH2-containing inositol phosphatase 1 (SHIP) is a 145 kDa hemopoietic-specific phosphatase that hydrolyzes phosphatidylinositol-3,4,5-triphosphate to phosphatidylinositol-3, 4-bisphosphate. SHIP has been shown to bind directly a phosphorylated motif, immunoreceptor tyrosine-based inhibition motif (ITIM), present in the cytoplasmic domain of FcgammaRIIB1 (1). Also, results demonstrate that FcgammaRIIB use SHIP1 to inhibit pathways shared by receptor tyrosine kinases and immunoreceptors to trigger cell proliferation and cell activation, respectively (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: INPP5D