SHIP Antibody

Images

 
Western Blot: SHIP Antibody [NBP2-49633] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human ...read more
Immunocytochemistry/ Immunofluorescence: SHIP Antibody [NBP2-49633] - Staining of human cell line Hep G2 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry: SHIP Antibody [NBP2-49633] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHIP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPAPRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQT
Specificity
Specificity of human SHIP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
INPP5D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SHIP Recombinant Protein Antigen (NBP2-49633PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHIP Antibody

  • 145kD
  • EC 3.1.3
  • hp51CNMGC142142
  • Inositol polyphosphate-5-phosphatase of 145 kDa
  • inositol polyphosphate-5-phosphatase, 145kDa
  • INPP5D
  • MGC104855
  • SHIP
  • SHIPMGC142140

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003636-M01
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67321
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-02434
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-33116
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5129
Species: Hu
Applications: WB
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, ICC/IF, IF
MAB847
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow, KO
NBP2-37454
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF3846
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-49633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SHIP Antibody (NBP2-49633) (0)

There are no publications for SHIP Antibody (NBP2-49633).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHIP Antibody (NBP2-49633) (0)

There are no reviews for SHIP Antibody (NBP2-49633). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SHIP Antibody (NBP2-49633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SHIP Products

Bioinformatics Tool for SHIP Antibody (NBP2-49633)

Discover related pathways, diseases and genes to SHIP Antibody (NBP2-49633). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHIP Antibody (NBP2-49633)

Discover more about diseases related to SHIP Antibody (NBP2-49633).
 

Pathways for SHIP Antibody (NBP2-49633)

View related products by pathway.

PTMs for SHIP Antibody (NBP2-49633)

Learn more about PTMs related to SHIP Antibody (NBP2-49633).
 

Research Areas for SHIP Antibody (NBP2-49633)

Find related products by research area.

Blogs on SHIP.

Getting SHIP-shape Over Tumour Suppression
PTEN antibodies have shown PTEN to be an important tumor suppressor and, in mutated form, a factor in cancer development. However, a recent study, led by Robert Rickert, shows that the SHIP gene may also be an important tumor suppressor in B-cell lymp...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol INPP5D