SHE Antibody

Images

 
Immunohistochemistry-Paraffin: SHE Antibody [NBP1-90996] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PYDAQQMITEIRRRGSKDPLVKALQLLDSPCEPADGGLKSETLAKRRSSKDLLGKPPQLYDTPY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SHE Protein (NBP1-90996PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHE Antibody

  • DKFZp451D1511
  • SH2 domain-containing adapter protein E
  • Src homology 2 domain containing E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB7740
Species: Mu
Applications: WB
NB100-93290
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF2567
Species: Mu
Applications: WB, IHC
AF3645
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
AF432
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-86053
Species: Hu
Applications: IHC, IHC-P
AF7036
Species: Hu
Applications: IHC
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2688
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-77368
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready

Publications for SHE Antibody (NBP1-90996) (0)

There are no publications for SHE Antibody (NBP1-90996).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHE Antibody (NBP1-90996) (0)

There are no reviews for SHE Antibody (NBP1-90996). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SHE Antibody (NBP1-90996) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHE Products

Bioinformatics Tool for SHE Antibody (NBP1-90996)

Discover related pathways, diseases and genes to SHE Antibody (NBP1-90996). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHE Antibody (NBP1-90996)

Discover more about diseases related to SHE Antibody (NBP1-90996).
 

Pathways for SHE Antibody (NBP1-90996)

View related products by pathway.

PTMs for SHE Antibody (NBP1-90996)

Learn more about PTMs related to SHE Antibody (NBP1-90996).

Blogs on SHE

There are no specific blogs for SHE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHE