SHC1 Antibody

Images

 
Immunohistochemistry: SHC1 Antibody [NBP1-87361] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SHC1 Protein (NBP1-87361PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHC1 Antibody

  • FLJ26504
  • p66
  • p66SHC
  • SH2 domain protein C1
  • SHC (Src homology 2 domain containing) transforming protein 1
  • SHC (Src homology 2 domain-containing) transforming protein 1
  • SHC
  • SHC1
  • SHCA
  • SHC-transforming protein 1
  • SHC-transforming protein 3
  • SHC-transforming protein A
  • Src homology 2 domain-containing-transforming protein C1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB38461
Species: Hu
Applications: WB, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2988
Species: Mu, Rt
Applications: WB
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-87361
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for SHC1 Antibody (NBP1-87361) (0)

There are no publications for SHC1 Antibody (NBP1-87361).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHC1 Antibody (NBP1-87361) (0)

There are no reviews for SHC1 Antibody (NBP1-87361). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SHC1 Antibody (NBP1-87361) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHC1 Products

Bioinformatics Tool for SHC1 Antibody (NBP1-87361)

Discover related pathways, diseases and genes to SHC1 Antibody (NBP1-87361). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHC1 Antibody (NBP1-87361)

Discover more about diseases related to SHC1 Antibody (NBP1-87361).
 

Pathways for SHC1 Antibody (NBP1-87361)

View related products by pathway.

PTMs for SHC1 Antibody (NBP1-87361)

Learn more about PTMs related to SHC1 Antibody (NBP1-87361).
 

Research Areas for SHC1 Antibody (NBP1-87361)

Find related products by research area.

Blogs on SHC1

There are no specific blogs for SHC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHC1
Entrez