SH3PX1 Antibody - BSA Free

Western Blot: SH3PX1 Antibody [NBP1-80777] - Analysis in human cell lines SK-MEL-30 and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Western Blot: SH3PX1 Antibody [NBP1-80777] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: SH3PX1 Antibody [NBP1-80777] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.

Immunohistochemistry-Paraffin: SH3PX1 Antibody [NBP1-80777] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SH3PX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SH3PX1 Antibody - BSA Free (NBP1-80777) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SH3PX1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNX9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SH3PX1 Protein (NBP1-80777PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SH3PX1 Antibody - BSA Free

• MST155
• MSTP155
• Protein SDP1
• SDP1
• SH3 and PX domain-containing protein 1
• SH3PX1WISP
• SH3PXD3ASH3 and PX domain-containing protein SH3PX1
• sorting nexin 9
• sorting nexin-9
• WiskSH3 and PX domain-containing protein 3A

Background

The SH3PX1 (SNX1) gene is part of the sorting nexin family, thus plays a role in several states of intracellular trafficking. There is only one isoform at 595 amino acids long and at a mass of around 66 kDA. The SH3PX1 gene has been linked to choanal atresia, alcoholism, asthma, rabies, neuronitis, and wiskitt-aldrich syndrome. It is involved in clathrin derived and trans-Golgi network vesicle budding as well as membrane trafficking through interactions with other genes such as ITCH, DNM2, SYNJ1, ASAP1, and ADAM15.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SH3PX1 Antibody (NBP1-80777)(2)

Publications using NBP1-80777

• Buttermore ED, Anderson NC, Chen PF et al. 16p13.11 deletion variants associated with neuropsychiatric disorders cause morphological and synaptic changes in induced pluripotent stem cell-derived neurons Frontiers in psychiatry 2022-11-03 [PMID: 36405918]
• Zhang H, Cavazzoni CB, Hanson BL et al. Transcriptionally Distinct B Cells Infiltrate Allografts After Kidney Transplantation Transplantation 2022-11-11 [PMID: 36398326] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: SNX9
• Entrez:
  • 51429(Human)
• Uniprot:
  • Q9Y5X1(Human)