SH3BGRL3 Antibody

Images

 
Western Blot: SH3BGRL3 Antibody [NBP2-85718] - Host: Rabbit. Target Name: SH3L3. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SH3BGRL3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SH3BGRL3. Peptide sequence: STSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SH3BGRL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SH3BGRL3 Antibody

  • SH3 domain binding glutamic acid-rich protein like 3
  • SH3 domain-binding glutamic acid-rich-like protein 3
  • SH3 domain-binding protein 1
  • SH3BGRL3-like protein
  • SH3BP-1
  • TIP-B1
  • TNF inhibitory protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33609
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3119
Species: Mu
Applications: WB
NBP2-38161
Species: Hu
Applications: IHC, IHC-P
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-18922
Species: Hu, Mu, Ma
Applications: WB, ICC/IF, IP
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-15587
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NB100-56479
Species: Hu, Mu, Rt, Po, Bv, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30993
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16051
Species: Hu
Applications: WB
NB100-56343
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC/IF, IP
NB110-57587
Species: Hu, Mu, Rt, Bv, Pm, Rb, Xp
Applications: WB, IHC, IHC-P, KD
NB100-56355
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-3446
Species: Hu, Mu, Rt, Ca, Ha, Rb
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-P, IP, KD
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-85718
Species: Hu
Applications: WB

Publications for SH3BGRL3 Antibody (NBP2-85718) (0)

There are no publications for SH3BGRL3 Antibody (NBP2-85718).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3BGRL3 Antibody (NBP2-85718) (0)

There are no reviews for SH3BGRL3 Antibody (NBP2-85718). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SH3BGRL3 Antibody (NBP2-85718) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SH3BGRL3 Products

Bioinformatics Tool for SH3BGRL3 Antibody (NBP2-85718)

Discover related pathways, diseases and genes to SH3BGRL3 Antibody (NBP2-85718). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3BGRL3 Antibody (NBP2-85718)

Discover more about diseases related to SH3BGRL3 Antibody (NBP2-85718).
 

Pathways for SH3BGRL3 Antibody (NBP2-85718)

View related products by pathway.

PTMs for SH3BGRL3 Antibody (NBP2-85718)

Learn more about PTMs related to SH3BGRL3 Antibody (NBP2-85718).

Blogs on SH3BGRL3

There are no specific blogs for SH3BGRL3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3BGRL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3BGRL3