SGPL1 Antibody (H00008879-D01P)

Images

 
Western Blot: SGPL1 Antibody [H00008879-D01P] - Analysis of SGPL1 expression in transfected 293T cell line by SGPL1 polyclonal antibody.Lane 1: SGPL1 transfected lysate(63.50 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SGPL1 Antibody Summary

Immunogen
SGPL1 (NP_003892.2, 1 a.a. - 568 a.a.) full-length human protein. MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQMNGSPKPH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGPL1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SGPL1 Antibody

  • EC 4.1.2.27
  • FLJ13811
  • hSPL
  • KIAA1252
  • S1PL
  • SGPL1
  • Sphingosine-1-phosphate aldolase
  • sphingosine-1-phosphate lyase 1
  • SPL
  • SPLSPL 1
  • SP-lyase 1
  • SP-lyase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30981
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00009200-R01
Species: Hu
NBP2-01650
Species: Hu, Mu, Mk
Applications: WB, Flow, IHC, IHC-P
NBP1-86644
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP
AF6386
Species: Hu
Applications: WB, IP
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003990-R01
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB600-232
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
MAB4077
Species: Hu
Applications: WB, IHC

Publications for SGPL1 Antibody (H00008879-D01P) (0)

There are no publications for SGPL1 Antibody (H00008879-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SGPL1 Antibody (H00008879-D01P) (0)

There are no reviews for SGPL1 Antibody (H00008879-D01P). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SGPL1 Antibody (H00008879-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SGPL1 Products

Related Products by Gene

Bioinformatics Tool for SGPL1 Antibody (H00008879-D01P)

Discover related pathways, diseases and genes to SGPL1 Antibody (H00008879-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SGPL1 Antibody (H00008879-D01P)

Discover more about diseases related to SGPL1 Antibody (H00008879-D01P).
 

Pathways for SGPL1 Antibody (H00008879-D01P)

View related products by pathway.

PTMs for SGPL1 Antibody (H00008879-D01P)

Learn more about PTMs related to SGPL1 Antibody (H00008879-D01P).
 

Research Areas for SGPL1 Antibody (H00008879-D01P)

Find related products by research area.

Blogs on SGPL1

There are no specific blogs for SGPL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SGPL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SGPL1
Entrez
Uniprot