SG2NA Antibody - BSA Free

Western Blot: SG2NA Antibody [NBP1-80763] - Analysis using Anti-STRN3 antibody NBP1-80763 (A) shows similar pattern to independent antibody NBP1-80764 (B).

Immunocytochemistry/Immunofluorescence: SG2NA Antibody [NBP1-80763] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SG2NA Antibody [NBP1-80763] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SG2NA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SG2NA Antibody - BSA Free (NBP1-80763) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SG2NA Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YEPNVLAGTLVGHTDAVWGLAYSGIKNQLLSCSADGTVRLWNPQEKLPCICTYNGDKKHGIPTSVDFIGCDPAHMVTSFNTGSAVIYDLETSQSLVILSSQVDSGLQSNNHINRVVSHPTLPVTITAHEDRHIKFFDNKTGKMI
• Predicted Species: Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STRN3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 87 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  SG2NA Protein (NBP1-80763PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SG2NA Antibody - BSA Free

• Cell cycle autoantigen SG2NA
• cell cycle S/G2 nuclear autoantigen
• GS2NA
• S/G2 antigen
• SG2NAnuclear autoantigen
• striatin, calmodulin binding protein 3
• striatin-3

Background

SG2NA was identified as a human cancer autoantigen and has now been implicated in vesicular trafficking and signal transduction. It is highly related to striatin and zinedin. It is a scaffolding protein that binds PP2A A and C subunits as well as the human homolog of the yeast protein, Mob1, which has been implicated in control of mitotic progression in yeast. It also binds calmodulin and appears to modulate PP2A activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SG2NA Antibody (NBP1-80763)(1)

Publication using NBP1-80763

• Taniguchi Y, Ouhara K, Kitagawa M et al. Periapical lesion following Cnm-positive Streptococcus mutans pulp infection worsens cerebral hemorrhage onset in an SHRSP rat model Clinical and experimental immunology 2022-11-11 [PMID: 36368020] (WB, Human)

Bioinformatics

• Gene Symbol: STRN3
• Entrez:
  • 29966(Human)
• Uniprot:
  • Q13033(Human)