SFRS15 Antibody

Images

 
Western Blot: SFRS15 Antibody [NBP1-88002] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: SFRS15 Antibody [NBP1-88002] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SFRS15 Antibody [NBP1-88002] - Staining of human colon shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SFRS15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MHHQVPLPPNGQMPGFGLLPTPPFPPMAQPVIPPTPPVQQPFQASFQAQNEPLTQKPHQQEMEVEQPCIQEVKRHMSDNRKSRSRSASRSPK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCAF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SFRS15 Protein (NBP1-88002PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SFRS15 Antibody

  • CTD-binding SR-like protein RA4
  • FLJ23364
  • KIAA1172arginine/serine-rich 15
  • SFRS15
  • SR-like CTD-associated factor 4
  • SR-related and CTD-associated factor 4
  • SR-related CTD-associated factor 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001195-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-86380
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBL1-12154
Species: Hu
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-92505
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2270
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-39084
Species: Hu
Applications: IHC, IHC-P
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16060
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF3075
Species: Hu
Applications: WB, ICC
NBP2-01367
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF497
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-536
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP, IF
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13837
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP

Publications for SFRS15 Antibody (NBP1-88002) (0)

There are no publications for SFRS15 Antibody (NBP1-88002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFRS15 Antibody (NBP1-88002) (0)

There are no reviews for SFRS15 Antibody (NBP1-88002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SFRS15 Antibody (NBP1-88002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SFRS15 Products

Bioinformatics Tool for SFRS15 Antibody (NBP1-88002)

Discover related pathways, diseases and genes to SFRS15 Antibody (NBP1-88002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SFRS15

There are no specific blogs for SFRS15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SFRS15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCAF4