SFRS15 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SFRS15 Antibody [NBP1-88002] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: SFRS15 Antibody [NBP1-88002] - Staining of human cerebral cortex, kidney, skeletal muscle and testis using Anti-SCAF4 antibody NBP1-88002 (A) shows similar protein distribution across tissues to independent antibody NBP1-88001 (B).

Immunohistochemistry-Paraffin: SFRS15 Antibody [NBP1-88002] - Staining in human testis and skeletal muscle tissues using anti-SCAF4 antibody. Corresponding SCAF4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SFRS15 Antibody [NBP1-88002] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: SFRS15 Antibody [NBP1-88002] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: SFRS15 Antibody [NBP1-88002] - Staining of human kidney.

Immunohistochemistry-Paraffin: SFRS15 Antibody [NBP1-88002] - Staining of human colon shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: SFRS15 Antibody [NBP1-88002] - Staining of human cerebral cortex.

Western Blot: SFRS15 Antibody [NBP1-88002] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Western Blot: SFRS15 Antibody [NBP1-88002] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-SCAF4 antibody. Remaining relative intensity is presented.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SFRS15 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MHHQVPLPPNGQMPGFGLLPTPPFPPMAQPVIPPTPPVQQPFQASFQAQNEPLTQKPHQQEMEVEQPCIQEVKRHMSDNRKSRSRSASRSPK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCAF4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SFRS15 Protein (NBP1-88002PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SFRS15 Antibody - BSA Free

• CTD-binding SR-like protein RA4
• FLJ23364
• KIAA1172arginine/serine-rich 15
• SFRS15
• SR-like CTD-associated factor 4
• SR-related and CTD-associated factor 4
• SR-related CTD-associated factor 4

Background

The SFRS15 gene likely encodes a member of the arginine/serine-rich splicing factor family. A similar protein in Rat appearsto bind the large subunit of RNA polymerase II and provide a link between transcription and pre-mRNA splicing.Alternatively spliced trans

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCAF4