SF3B2 Antibody (5D2) - Azide and BSA Free

Western Blot: SF3B2 Antibody (5D2) [H00010992-M01] - SF3B2 monoclonal antibody (M01), clone 5D2 Analysis of SF3B2 expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: SF3B2 Antibody (5D2) [H00010992-M01] - Analysis of monoclonal antibody to SF3B2 on HeLa cell. Antibody concentration 60 ug/ml.

Immunohistochemistry-Paraffin: SF3B2 Antibody (5D2) [H00010992-M01] - Analysis of monoclonal antibody to SF3B2 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 6 ug/ml.

Western Blot: SF3B2 Antibody (5D2) [H00010992-M01] - SF3B2 monoclonal antibody (M01), clone 5D2. Analysis of SF3B2 expression in PC-12.

Western Blot: SF3B2 Antibody (5D2) [H00010992-M01] - SF3B2 monoclonal antibody (M01), clone 5D2. Analysis of SF3B2 expression in NIH/3T3.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 5D2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SF3B2 Antibody (5D2) - Azide and BSA Free Summary

• Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 645 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY
• Specificity: SF3B2 (5D2)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SF3B2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
• Control:

  HeLa Nuclear Cell Lysate

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SF3B2 Antibody (5D2) - Azide and BSA Free

• Cus1
• pre-mRNA splicing factor SF3b 145 kDa subunit
• Pre-mRNA-splicing factor SF3b 145 kDa subunit
• SAP145SAP 145
• SF3b1
• SF3B145
• SF3b150
• spliceosome associated protein 145
• Spliceosome-associated protein 145
• splicing factor 3B subunit 2
• splicing factor 3b, subunit 2, 145kD
• splicing factor 3b, subunit 2, 145kDa

Background

This gene encodes subunit 2 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 2 associates with pre-mRNA upstream of the branch site at the anchoring site. Subunit 2 also interacts directly with subunit 4 of the splicing factor 3b complex. Subunit 2 is a highly hydrophilic protein with a proline-rich N-terminus and a glutamate-rich stretch in the C-terminus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SF3B2
• Entrez:
  • 10992(Human)
  • 319322(Mouse)
  • 293671(Rat)
• OMIM:
  • 605591(Human)
• Uniprot:
  • NP_006833(Human)