SET1B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SET1B Antibody [NBP2-55848] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SET1B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GLQFVNLPPYRGPFSLSNSGPGRGQHWPPLPKFDPSVPPPGYMPRQEDPHKATVDGVLLVVLKELKAIMK
Specificity
Specificity of human SET1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SETD1B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SET1B Recombinant Protein Antigen (NBP2-55848PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SET1B Antibody

  • EC 2.1.1
  • FLJ20803
  • histone-lysine N-methyltransferase SETD1B
  • hSET1B
  • KIAA1076EC 2.1.1.43
  • KMT2GSET1B
  • Lysine N-methyltransferase 2G
  • SET domain containing 1B
  • SET domain-containing protein 1B
  • Set1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-558
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP2-92895
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-864
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-89123
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-250
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF5810
Species: Hu, Mu
Applications: WB, IHC
NBP1-88542
Species: Hu
Applications: WB, IHC, IHC-P
NB600-252
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, CHIP-SEQ
NBP2-57730
Species: Hu
Applications: ICC/IF
NBP2-57428
Species: Hu
Applications: WB, ICC/IF
NB100-56519
Species: Hu, Mu, Rt, Po, Bv, Sh
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, IHC-FrFl, KD
AF6539
Species: Hu
Applications: WB, IHC
NBP1-84294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82465
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88498
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-215
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD

Publications for SET1B Antibody (NBP2-55848) (0)

There are no publications for SET1B Antibody (NBP2-55848).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SET1B Antibody (NBP2-55848) (0)

There are no reviews for SET1B Antibody (NBP2-55848). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SET1B Antibody (NBP2-55848) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SET1B Products

Array NBP2-55848

Bioinformatics Tool for SET1B Antibody (NBP2-55848)

Discover related pathways, diseases and genes to SET1B Antibody (NBP2-55848). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SET1B Antibody (NBP2-55848)

Discover more about diseases related to SET1B Antibody (NBP2-55848).
 

Pathways for SET1B Antibody (NBP2-55848)

View related products by pathway.

PTMs for SET1B Antibody (NBP2-55848)

Learn more about PTMs related to SET1B Antibody (NBP2-55848).

Blogs on SET1B

There are no specific blogs for SET1B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SET1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SETD1B