SESN2 Antibody (8I1W4)

Western Blot: SESN2 Antibody (8I1W4) [NBP3-33447] - Western blot analysis of various lysates, using SESN2 Rabbit mAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.

Western Blot: SESN2 Antibody (8I1W4) [NBP3-33447] - Western blot analysis of various lysates, using SESN2 Rabbit mAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 8I1W4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SESN2 Antibody (8I1W4) Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human SESN2 (NP_113647.1).
  
  Sequence:
  SADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCV
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SESN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 54 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for SESN2 Antibody (8I1W4)

• DKFZp761M0212
• DKFZp761M02121
• Hi95
• HI95sestrin-2
• SES2
• SEST2hypoxia induced gene 95
• sestrin 2

Background

SESN2 encodes a member of the sestrin family of PA26-related proteins. The encoded protein may function in the regulation of cell growth and survival. This protein may be involved in cellular response to different stress conditions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SESN2