Recombinant Human SESN1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SESN1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 271-370 of Human SESN1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LASFTFGCGISPEIHCDGGHTFRPPSVSNYCICDITNGNHSVDEMPVNSAENVSVSDSFFEVEALMEKMRQLQECRDEEEASQEEMASRFEIEKRESMFV

Protein/Peptide Type
Partial Recombinant Protein
Gene
SESN1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SESN1 Protein

  • MGC138241
  • MGC142129
  • p53-regulated protein PA26
  • PA26p53 activated gene 26
  • SEST1p53 regulated PA26 nuclear protein
  • sestrin 1
  • sestrin-1

Background

SESN1 - sestrin 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00083667-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-31702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF5510
Species: Hu
Applications: WB
NBP1-83121
Species: Hu
Applications: WB, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
H00000900-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-49534
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00027244-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SESN1 Partial Recombinant Protein (H00027244-Q01) (0)

There are no publications for SESN1 Partial Recombinant Protein (H00027244-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SESN1 Partial Recombinant Protein (H00027244-Q01) (0)

There are no reviews for SESN1 Partial Recombinant Protein (H00027244-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SESN1 Partial Recombinant Protein (H00027244-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SESN1 Products

Bioinformatics Tool for SESN1 Partial Recombinant Protein (H00027244-Q01)

Discover related pathways, diseases and genes to SESN1 Partial Recombinant Protein (H00027244-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SESN1 Partial Recombinant Protein (H00027244-Q01)

Discover more about diseases related to SESN1 Partial Recombinant Protein (H00027244-Q01).
 

Pathways for SESN1 Partial Recombinant Protein (H00027244-Q01)

View related products by pathway.

PTMs for SESN1 Partial Recombinant Protein (H00027244-Q01)

Learn more about PTMs related to SESN1 Partial Recombinant Protein (H00027244-Q01).
 

Research Areas for SESN1 Partial Recombinant Protein (H00027244-Q01)

Find related products by research area.

Blogs on SESN1

There are no specific blogs for SESN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SESN1 Antibody
H00027244-B01P
Mre11 Antibody
NB100-142

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SESN1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SESN1