SerpinB9 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SERPINB9. Source: E. coli
Amino Acid Sequence: YFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
SERPINB9 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33924. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SerpinB9 Recombinant Protein Antigen
Background
SerpinB9 is a serine proteinase inhibitor of the ovalbumin like B clade of serpins. The mouse orthologue to PI9 is SPI-6. SerpinB9 was first discovered in human bone marrow in a search for serpins similar to SerpinB6. SerpinB9 was identified in lymphocytes, especially natural killer cells and cytotoxic T lymphocytes, cells which also produce and store the apoptosis-inducing enzyme Granzyme B. PI9 was shown to be a potent inhibitor of Granzyme B, working at picamolar efficiencies. PI9 was also shown to inhibit caspase 1, the interleukin 1 converting enzyme, thus blocking IL1 223; production, and decreasing inflammatory processes. Most leukemia cells and many tumor cells produce PI9, leading to speculation that PI9 may help protect tumor cells from destruction by NK and CTL cells. PI9 is also found in placenta, lung, kidney, mast cells, and many tissues and cell lines. In kidney transplant, PI9 is sharply elevated, and in the liver PI9 has been shown to be upregulated by a downstream estrogen promoter. SerpinB9 inhibits Granzyme B, and is cleaved by Granzyme M, as a down regulatory step. SerpinB9 also inhibits the bacterial proteinase subtilisin A, and this may be a protective agent against infections. Neutrophil elastase is also a target of SerpinB9. Like SerpinB6 and SerpinB8, SerpinB9 lacks a signal sequence, and is found mainly in the cytoplasm and nucleus, although it can be detected outside of cells and in serum. The original SerpinB9 sequence described was 379 amino acids in length, with predicted mass of 42.4 kDa and pI of 5.51.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Ca, Hu, Pm, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Mu
Applications: ELISA
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IP, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: AC
Publications for SerpinB9 Protein (NBP2-33924PEP) (0)
There are no publications for SerpinB9 Protein (NBP2-33924PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SerpinB9 Protein (NBP2-33924PEP) (0)
There are no reviews for SerpinB9 Protein (NBP2-33924PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SerpinB9 Protein (NBP2-33924PEP) (0)
Additional SerpinB9 Products
Research Areas for SerpinB9 Protein (NBP2-33924PEP)
Find related products by research area.
|
Blogs on SerpinB9