SerpinB9 Recombinant Protein Antigen

Images

 
There are currently no images for SerpinB9 Protein (NBP2-33924PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SerpinB9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SERPINB9.

Source: E. coli

Amino Acid Sequence: YFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SERPINB9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33924.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SerpinB9 Recombinant Protein Antigen

  • CAP-3
  • CAP3PI-9
  • Cytoplasmic antiproteinase 3
  • Peptidase inhibitor 9
  • PI9protease inhibitor 9 (ovalbumin type)
  • serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9
  • serpin B9
  • serpin peptidase inhibitor, clade B (ovalbumin), member 9
  • serpin peptidase inhibitor, clade B, member 9

Background

SerpinB9 is a serine proteinase inhibitor of the ovalbumin like B clade of serpins. The mouse orthologue to PI9 is SPI-6. SerpinB9 was first discovered in human bone marrow in a search for serpins similar to SerpinB6. SerpinB9 was identified in lymphocytes, especially natural killer cells and cytotoxic T lymphocytes, cells which also produce and store the apoptosis-inducing enzyme Granzyme B. PI9 was shown to be a potent inhibitor of Granzyme B, working at picamolar efficiencies. PI9 was also shown to inhibit caspase 1, the interleukin 1 converting enzyme, thus blocking IL1 223; production, and decreasing inflammatory processes. Most leukemia cells and many tumor cells produce PI9, leading to speculation that PI9 may help protect tumor cells from destruction by NK and CTL cells. PI9 is also found in placenta, lung, kidney, mast cells, and many tissues and cell lines. In kidney transplant, PI9 is sharply elevated, and in the liver PI9 has been shown to be upregulated by a downstream estrogen promoter. SerpinB9 inhibits Granzyme B, and is cleaved by Granzyme M, as a down regulatory step. SerpinB9 also inhibits the bacterial proteinase subtilisin A, and this may be a protective agent against infections. Neutrophil elastase is also a target of SerpinB9. Like SerpinB6 and SerpinB8, SerpinB9 lacks a signal sequence, and is found mainly in the cytoplasm and nucleus, although it can be detected outside of cells and in serum. The original SerpinB9 sequence described was 379 amino acids in length, with predicted mass of 42.4 kDa and pI of 5.51.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01650
Species: Hu, Pm, Mu
Applications: Flow, IHC,  IHC-P, WB
MAB4158
Species: Hu
Applications: IHC
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-03828
Species: Ca, Hu, Pm, Pm, Rt
Applications: Flow, IHC,  IHC-P, WB
DY4517-05
Species: Mu
Applications: ELISA
NB600-922
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
NBP1-86644
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
7398-FS
Species: Hu
Applications: BA
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF4599
Species: Hu
Applications: IHC, IP, Simple Western, WB
DFL00B
Species: Hu
Applications: ELISA
NB100-56176
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-30572
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33188
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-33924PEP
Species: Hu
Applications: AC

Publications for SerpinB9 Protein (NBP2-33924PEP) (0)

There are no publications for SerpinB9 Protein (NBP2-33924PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SerpinB9 Protein (NBP2-33924PEP) (0)

There are no reviews for SerpinB9 Protein (NBP2-33924PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SerpinB9 Protein (NBP2-33924PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SerpinB9 Products

Research Areas for SerpinB9 Protein (NBP2-33924PEP)

Find related products by research area.

Blogs on SerpinB9

There are no specific blogs for SerpinB9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SerpinB9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINB9