Serpin E1/PAI-1 Recombinant Protein Antigen

Images

 
There are currently no images for Serpin E1/PAI-1 Protein (NBP2-13298PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Serpin E1/PAI-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SERPINE1.

Source: E. coli

Amino Acid Sequence: RLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SERPINE1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13298.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Serpin E1/PAI-1 Recombinant Protein Antigen

  • Endothelial plasminogen activator inhibitor
  • Nexin
  • PAI1
  • PAI-1
  • PAI1PAI-1
  • PAISerpin E1
  • PLANH1
  • PLANH1plasminogen activator inhibitor 1
  • serine (or cysteine) proteinase inhibitor, clade E (nexin, plasminogenactivator inhibitor type 1), member 1
  • Serpin E1
  • serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitortype 1), member 1

Background

PAI-1 and PAI-2 (for plasminogen activator inhibitor-1 and -2) are members of the serpin serine proteinase inhibitor family. PAI-1 and PAI-2 have been shown to regulate uPA (urokinase-type plasminogen activator) and tPA (tissue plasminogen activator), resulting in the inhibition of proteolytic activity. Members of the serpin family generally complex with their target proteinases, then disassociate slowly into cleaved species that fold into stable inactive forms. PAI-1 can fold into the inactive state without cleavage, resulting in the latent form of PAI-1. Activity can be restored to the latent form of PAI-1 through denaturation and renaturation. PAI-2 occurs in secreted and cytosolic forms through facultative polypeptide translocation. uPA is a serine proteinase that is a member of the trypsin family. It is responsible for the cleavage of plasminogen at the Arg-Val bond to produce plasmin. uPA consists of two chains designated A and B. The A chain can be cleaved, resulting in low and high molecular mass forms of uPA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-930
Species: Hu, Rt
Applications: ELISA, WB
DTPA00
Species: Hu
Applications: ELISA
1310-SE
Species: Hu
Applications: EnzAct
NBP1-80633
Species: Hu
Applications: IHC,  IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
M6000B
Species: Mu
Applications: ELISA
DUP00
Species: Hu
Applications: ELISA
NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P
MAB8550
Species: Hu
Applications: CyTOF-ready, Flow, ICC, KO, WB
NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
AF1267
Species: Hu
Applications: IP, Neut, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB

Publications for Serpin E1/PAI-1 Protein (NBP2-13298PEP) (0)

There are no publications for Serpin E1/PAI-1 Protein (NBP2-13298PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin E1/PAI-1 Protein (NBP2-13298PEP) (0)

There are no reviews for Serpin E1/PAI-1 Protein (NBP2-13298PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Serpin E1/PAI-1 Protein (NBP2-13298PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Serpin E1/PAI-1 Products

Research Areas for Serpin E1/PAI-1 Protein (NBP2-13298PEP)

Find related products by research area.

Blogs on Serpin E1/PAI-1

There are no specific blogs for Serpin E1/PAI-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Serpin E1/PAI-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINE1