Serpin B3/SCCA1 Antibody

Images

 
Western Blot: Serpin B3/SCCA1 Antibody [H00006317-B01P] - Analysis of SERPINB3 expression in Hela S3 NE.
Western Blot: Serpin B3/SCCA1 Antibody [H00006317-B01P] - Analysis of SERPINB3 expression in transfected 293T cell line by SERPINB3 polyclonal antibody. Lane 1: SERPINB3 transfected lysate(42.9 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Serpin B3/SCCA1 Antibody Summary

Immunogen
SERPINB3 (NP_008850.1, 1 a.a. - 390 a.a.) full-length human protein. MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Specificity
Reacts with serpin peptidase inhibitor, clade B (ovalbumin), member 3.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SERPINB3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Serpin B3/SCCA1 Antibody

  • HsT1196
  • Protein T4-A
  • SCC
  • SCCA
  • SCCA1
  • SCCA1SCCA-1
  • SCCA-PD
  • serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3
  • Serpin B3
  • serpin peptidase inhibitor, clade B (ovalbumin), member 3
  • Squamous cell carcinoma antigen 1
  • T4-A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-03595
Species: Hu
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
H00006317-B01P
Species: Hu
Applications: WB

Publications for Serpin B3/SCCA1 Antibody (H00006317-B01P) (0)

There are no publications for Serpin B3/SCCA1 Antibody (H00006317-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin B3/SCCA1 Antibody (H00006317-B01P) (0)

There are no reviews for Serpin B3/SCCA1 Antibody (H00006317-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Serpin B3/SCCA1 Antibody (H00006317-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serpin B3/SCCA1 Products

Bioinformatics Tool for Serpin B3/SCCA1 Antibody (H00006317-B01P)

Discover related pathways, diseases and genes to Serpin B3/SCCA1 Antibody (H00006317-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin B3/SCCA1 Antibody (H00006317-B01P)

Discover more about diseases related to Serpin B3/SCCA1 Antibody (H00006317-B01P).
 

Pathways for Serpin B3/SCCA1 Antibody (H00006317-B01P)

View related products by pathway.

PTMs for Serpin B3/SCCA1 Antibody (H00006317-B01P)

Learn more about PTMs related to Serpin B3/SCCA1 Antibody (H00006317-B01P).
 

Research Areas for Serpin B3/SCCA1 Antibody (H00006317-B01P)

Find related products by research area.

Blogs on Serpin B3/SCCA1

There are no specific blogs for Serpin B3/SCCA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin B3/SCCA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINB3
Entrez
Uniprot