Serpin A5/Protein C Inhibitor Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Serpin A5/Protein C Inhibitor Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Serpin A5/Protein C Inhibitor
  
  

  Source: E.coli

  Amino Acid Sequence: KWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNAT

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SERPINA5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17021It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Serpin A5/Protein C Inhibitor Recombinant Protein Antigen

• Acrosomal serine protease inhibitor
• antitrypsin), member 5
• member 5
• PAI-3
• PAI3PLANH3
• PCI
• PCIplasminogen activator inhibitor III
• Plasminogen activator inhibitor 3
• plasminogen activator inhibitor-3
• PROCIplasma serine protease inhibitor
• Protein C inhibitor
• serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase
• Serpin A5
• serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin)
• SERPNA5

Background

PAI-1, PAI-2 and PAI-3 (plasminogen activator inhibitor-1, -2 and -3) are members of the serpin serine proteinase inhibitor family. PAI-1 and PAI-2 regulate uPA (urokinase-type plasminogen activator) and TPA (tissue plasminogen activator), resulting in the inhibition of proteolytic activity. Members of the serpin family generally complex with their target proteinases, then disassociate slowly into cleaved species that fold into stable inactive forms. PAI-1 can fold into the inactive state without cleavage resulting in the latent form of PAI-1. Activity can be restored to the latent form of PAI-1 through denaturation and renaturation. PAI-2 occurs in secreted and cytosolic forms through facultative polypeptide translocation. PAI-3 inhibits plasminogen activators as well as activated protein C. PAI-3 is secreted in plasma, but is also expressed in liver.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SERPINA5