We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Serpin A5/Protein C Inhibitor Recombinant Protein Antigen

Images

 
There are currently no images for Serpin A5/Protein C Inhibitor Recombinant Protein Antigen (NBP3-17021PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Serpin A5/Protein C Inhibitor Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Serpin A5/Protein C Inhibitor

Source: E.coli

Amino Acid Sequence: KWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNAT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
SERPINA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17021It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Serpin A5/Protein C Inhibitor Recombinant Protein Antigen

  • Acrosomal serine protease inhibitor
  • antitrypsin), member 5
  • member 5
  • PAI-3
  • PAI3PLANH3
  • PCI
  • PCIplasminogen activator inhibitor III
  • Plasminogen activator inhibitor 3
  • plasminogen activator inhibitor-3
  • PROCIplasma serine protease inhibitor
  • Protein C inhibitor
  • serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase
  • Serpin A5
  • serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin)
  • SERPNA5

Background

PAI-1, PAI-2 and PAI-3 (plasminogen activator inhibitor-1, -2 and -3) are members of the serpin serine proteinase inhibitor family. PAI-1 and PAI-2 regulate uPA (urokinase-type plasminogen activator) and TPA (tissue plasminogen activator), resulting in the inhibition of proteolytic activity. Members of the serpin family generally complex with their target proteinases, then disassociate slowly into cleaved species that fold into stable inactive forms. PAI-1 can fold into the inactive state without cleavage resulting in the latent form of PAI-1. Activity can be restored to the latent form of PAI-1 through denaturation and renaturation. PAI-2 occurs in secreted and cytosolic forms through facultative polypeptide translocation. PAI-3 inhibits plasminogen activators as well as activated protein C. PAI-3 is secreted in plasma, but is also expressed in liver.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY1707
Species: Hu
Applications: ELISA
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF5769
Species: Hu
Applications: IHC, WB
NBP1-90276
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92089
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-90260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF4885
Species: Mu
Applications: IP, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-78249
Species: Hu, Pm, Mu, Po, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
DTPA00
Species: Hu
Applications: ELISA
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP1-86856
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
1310-SE
Species: Hu
Applications: EnzAct
DKK300
Species: Hu
Applications: ELISA

Publications for Serpin A5/Protein C Inhibitor Recombinant Protein Antigen (NBP3-17021PEP) (0)

There are no publications for Serpin A5/Protein C Inhibitor Recombinant Protein Antigen (NBP3-17021PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin A5/Protein C Inhibitor Recombinant Protein Antigen (NBP3-17021PEP) (0)

There are no reviews for Serpin A5/Protein C Inhibitor Recombinant Protein Antigen (NBP3-17021PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Serpin A5/Protein C Inhibitor Recombinant Protein Antigen (NBP3-17021PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Serpin A5/Protein C Inhibitor Products

Research Areas for Serpin A5/Protein C Inhibitor Recombinant Protein Antigen (NBP3-17021PEP)

Find related products by research area.

Blogs on Serpin A5/Protein C Inhibitor

There are no specific blogs for Serpin A5/Protein C Inhibitor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Serpin A5/Protein C Inhibitor Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINA5