![Immunohistochemistry-Paraffin: Serine protease 23 Antibody [NBP1-80748] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/antibody/nbp1-80748_rabbit-polyclonal-serine-protease-23-antibody-immunohistochemistry-paraffin-99202482944..jpg "Immunohistochemistry-Paraffin: Serine protease 23 Antibody [NBP1-80748] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGA |
| Predicted Species | Mouse (91%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PRSS23 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Serine protease 23 Antibody (NBP1-80748)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Serine protease 23 Antibody [NBP1-80748] - Staining of human placenta shows moderate positivity in plasma.](http://images.novusbio.com/fullsize/antibody/nbp1-80748_rabbit-polyclonal-serine-protease-23-antibody-immunohistochemistry-paraffin-99202483046..jpg "Immunohistochemistry-Paraffin: Serine protease 23 Antibody [NBP1-80748] - Staining of human placenta shows moderate positivity in plasma.")
![Immunohistochemistry-Paraffin: Serine protease 23 Antibody [NBP1-80748] - Staining of human cerebral cortex shows no positivity in neuronal cells as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-80748_rabbit-polyclonal-serine-protease-23-antibody-immunohistochemistry-paraffin-99202483159..jpg "Immunohistochemistry-Paraffin: Serine protease 23 Antibody [NBP1-80748] - Staining of human cerebral cortex shows no positivity in neuronal cells as expected.")
![Immunohistochemistry-Paraffin: Serine protease 23 Antibody [NBP1-80748] - Staining of human duodenum shows low expression in glandular cells as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-80748_rabbit-polyclonal-serine-protease-23-antibody-immunohistochemistry-paraffin-99202483332..jpg "Immunohistochemistry-Paraffin: Serine protease 23 Antibody [NBP1-80748] - Staining of human duodenum shows low expression in glandular cells as expected.")
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Western Blot HTRA1/PRSS11 Antibody (275615) [Unconjugated]](https://images.novusbio.com/images2/HTRA1_MAB2916_Western_Blot_11032.jpg)
![Western Blot HTRA1/PRSS11 Antibody (275615) [Unconjugated]](https://images.novusbio.com/images/mab2916_human-htra1-prss11-mab-clone-275615-41202412514842.jpg)
![Western Blot HTRA1/PRSS11 Antibody (275615) [Unconjugated]](https://images.novusbio.com/images/mab2916_human-htra1-prss11-mab-clone-275615-41202412513811.jpg)
![Western Blot GPER/GPR30 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPER_AF5534_Western_Blot_5749.jpg)
![Immunohistochemistry GPER/GPR30 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPER_AF5534_Immunohistochemistry_11477.jpg)
![Flow Cytometry GPER/GPR30 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPER_AF5534_Flow_Cytometry_22083.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")