SERCA2 ATPase Antibody - BSA Free

Western Blot: SERCA2 ATPase Antibody [NBP1-59203] - (G) Immunoblots of control (C) and proband (P1, P2, P3) cell lysates demonstrate equivalent levels of SERCA2b and IP3R1 Ca2+ channels using rabbit anti-SERCA2 (Novus Biologicals; NBP1-59203) and rabbit anti-IP3R1 (Novus Biologicals; NB120-5908). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/27441836) licensed under a CC-BY license.

Immunohistochemistry: SERCA2 ATPase Antibody [NBP1-59203] - Rhesus macaque spinal cord Primary Antibody Dilution: 1 : 300 Secondary Antibody: Donkey anti Rabbit 488 Secondary Antibody Dilution: 1 : 500Color/Signal Descriptions: Green: ATP2A2 Gene name: APLP2 Submitted by: Timur Mavlyutov, Ph. D. , Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706.

Western Blot: SERCA2 ATPase Antibody [NBP1-59203] - Human MCF-7. Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

• Reactivity: Hu, Mu, Pm
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SERCA2 ATPase Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ATP2A2(ATPase, Ca++ transporting, cardiac muscle, slow twitch 2) The peptide sequence was selected from the C terminal of ATP2A2. Peptide sequence VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP2A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 115 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SERCA2 ATPase Antibody - BSA Free

• ATP2A2
• ATP2B
• ATP2BFLJ20293
• ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2
• ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
• Calcium pump 2
• Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletalmuscle isoform
• cardiac Ca2+ ATPase
• DAR
• DD
• EC 3.6.3
• EC 3.6.3.8
• Endoplasmic reticulum class 1/2 Ca(2+) ATPase
• FLJ38063
• MGC45367
• sarcoplasmic/endoplasmic reticulum calcium ATPase 2
• SERCA2 ATPase
• SERCA2
• SERCA2DKFZp686P0211
• SR Ca(2+)-ATPase 2

Background

ATP2A2 is one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Alternative splicing results in multiple transcript variants encoding different isoforms.This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Alternative splicing results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SERCA2 ATPase Antibody (NBP1-59203)(1)

Publication using NBP1-59203

• Cabral WA, Ishikawa M, Garten M et al. Absence of the ER Cation Channel TMEM38B/TRIC-B Disrupts Intracellular Calcium Homeostasis and Dysregulates Collagen Synthesis in Recessive Osteogenesis Imperfecta. PLoS Genet 2016-07-01 [PMID: 27441836] (WB)

Bioinformatics

• Gene Symbol: ATP2A2
• Uniprot:
  • P16615(Human)