SERBP1 Antibody

Images

 
Western Blot: SERBP1 Antibody [NBP1-85660] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: SERBP1 Antibody [NBP1-85660] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: SERBP1 Antibody [NBP1-85660] - Staining of human cervix, uterine shows strong cytoplasmic positivity in squamous epithelial cells.
Western Blot: SERBP1 Antibody [NBP1-85660] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: SERBP1 Antibody [NBP1-85660] - Staining of human kidney shows strong cytoplasmic positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SERBP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQLRKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SERBP1 Protein (NBP1-85660PEP)
Publications
Read Publications using NBP1-85660.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SERBP1 Antibody

  • CGI-55
  • CHD3IP
  • chromodomain helicase DNA binding protein 3 interacting protein
  • DKFZP564M2423
  • HABP4L
  • PAI-1 mRNA binding protein
  • PAI1 RNA-binding protein 1
  • PAI-RBP1DKFZp564M2423
  • PAIRBP1FLJ90489
  • plasminogen activator inhibitor 1 RNA binding protein
  • plasminogen activator inhibitor 1 RNA-binding protein
  • SERPINE1 mRNA binding protein 1
  • SERPINE1 mRNA-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83220
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-30907
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2251
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-51593
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00010424-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-07799
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-85309
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-26616
Species: Hu
Applications: WB, IP
NBP1-85660
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SERBP1 Antibody (NBP1-85660)(2)

Reviews for SERBP1 Antibody (NBP1-85660) (0)

There are no reviews for SERBP1 Antibody (NBP1-85660). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SERBP1 Antibody (NBP1-85660) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SERBP1 Products

Bioinformatics Tool for SERBP1 Antibody (NBP1-85660)

Discover related pathways, diseases and genes to SERBP1 Antibody (NBP1-85660). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SERBP1 Antibody (NBP1-85660)

Discover more about diseases related to SERBP1 Antibody (NBP1-85660).
 

Pathways for SERBP1 Antibody (NBP1-85660)

View related products by pathway.

PTMs for SERBP1 Antibody (NBP1-85660)

Learn more about PTMs related to SERBP1 Antibody (NBP1-85660).

Blogs on SERBP1

There are no specific blogs for SERBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SERBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERBP1