SEPHS1 Antibody


Western Blot: SEPHS1 Antibody [NBP1-87008] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: SEPHS1 Antibody [NBP1-87008] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: SEPHS1 Antibody [NBP1-87008] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

Product Details

Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

SEPHS1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:MSTRESFNPESYELDKSFRLTRFTELKGTGCKVP
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SEPHS1 Protein (NBP1-87008PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SEPHS1 Antibody

  • EC
  • MGC4980
  • SELD
  • Selenium donor protein 1
  • Selenophosphate synthase 1
  • selenophosphate synthetase 1 +E9a
  • selenophosphate synthetase 1 delta E2
  • selenophosphate synthetase 1 delta E8
  • selenophosphate synthetase 1 major
  • selenophosphate synthetase 1
  • SPS1selenophosphate synthetase 1 +E9
  • water dikinase 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SEPHS1 Antibody (NBP1-87008) (0)

There are no publications for SEPHS1 Antibody (NBP1-87008).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEPHS1 Antibody (NBP1-87008) (0)

There are no reviews for SEPHS1 Antibody (NBP1-87008). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SEPHS1 Antibody (NBP1-87008) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SEPHS1 Products

Bioinformatics Tool for SEPHS1 Antibody (NBP1-87008)

Discover related pathways, diseases and genes to SEPHS1 Antibody (NBP1-87008). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEPHS1 Antibody (NBP1-87008)

Discover more about diseases related to SEPHS1 Antibody (NBP1-87008).

Pathways for SEPHS1 Antibody (NBP1-87008)

View related products by pathway.

Research Areas for SEPHS1 Antibody (NBP1-87008)

Find related products by research area.

Blogs on SEPHS1

There are no specific blogs for SEPHS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SEPHS1 Antibody and receive a gift card or discount.


Gene Symbol SEPHS1