SENP7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SENP7 Antibody [NBP1-86394] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: SENP7 Antibody [NBP1-86394] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SENP7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:STISTEFEKPSENYHQDPKLPEEITTKPTKSDFTKLSSLNSQELTLSNATKSASAGSTTETVENSNSIDIVGISSLVEKDENELNTIEKPILRGHNEGNQSLISAEPIVVSSDEEGPVEHKSSEILKLQSKQDRE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SENP7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SENP7 Protein (NBP1-86394PEP)
Publications
Read Publication using NBP1-86394.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SENP7 Antibody

  • EC 3.4.22.-
  • KIAA1707SUMO1/sentrin specific protease 7
  • MGC157730
  • Sentrin/SUMO-specific protease SENP7
  • sentrin-specific protease 7
  • SSP2
  • SUMO1/sentrin specific peptidase 7
  • SUMO-1-specific protease 2
  • SUSP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32901
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
H00026054-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87974
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56405
Species: Hu, Mu
Applications: WB, Simple Western
NB100-56444
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-24651
Species: Hu, Mu, Eq, Pm
Applications: WB
NBP1-83060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03852
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00079092-T01
Species: Hu
NBP1-86394
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SENP7 Antibody (NBP1-86394)(1)

Reviews for SENP7 Antibody (NBP1-86394) (0)

There are no reviews for SENP7 Antibody (NBP1-86394). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SENP7 Antibody (NBP1-86394) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SENP7 Products

Bioinformatics Tool for SENP7 Antibody (NBP1-86394)

Discover related pathways, diseases and genes to SENP7 Antibody (NBP1-86394). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SENP7 Antibody (NBP1-86394)

Discover more about diseases related to SENP7 Antibody (NBP1-86394).
 

Pathways for SENP7 Antibody (NBP1-86394)

View related products by pathway.

PTMs for SENP7 Antibody (NBP1-86394)

Learn more about PTMs related to SENP7 Antibody (NBP1-86394).

Blogs on SENP7

There are no specific blogs for SENP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SENP7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SENP7