SENP7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SENP7 Antibody [NBP1-86394] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: SENP7 Antibody [NBP1-86394] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.

Immunohistochemistry-Paraffin: SENP7 Antibody [NBP1-86394] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: SENP7 Antibody [NBP1-86394] - Staining of human endometrium shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: SENP7 Antibody [NBP1-86394] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SENP7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SENP7 Antibody - BSA Free (NBP1-86394) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-SENP7 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: STISTEFEKPSENYHQDPKLPEEITTKPTKSDFTKLSSLNSQELTLSNATKSASAGSTTETVENSNSIDIVGISSLVEKDENELNTIEKPILRGHNEGNQSLISAEPIVVSSDEEGPVEHKSSEILKLQSKQDRE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SENP7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SENP7 Protein (NBP1-86394PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SENP7 Antibody - BSA Free

• EC 3.4.22.-
• KIAA1707SUMO1/sentrin specific protease 7
• MGC157730
• Sentrin/SUMO-specific protease SENP7
• sentrin-specific protease 7
• SSP2
• SUMO1/sentrin specific peptidase 7
• SUMO-1-specific protease 2
• SUSP2

Background

SENP7, SAE1, or SUMO-1 specific protease 2 is a ubiquitin-like (Ubl) protein that has been shown to bind to several protiens including Ran GTPase-activating protein 1 (RanGAP1), IkappaBalpha, and PML. These bindings implicate SUMO in the stabilization of the target proteins and/or their localization to subcellular complexes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SENP7 Antibody (NBP1-86394)(1)

Publication using NBP1-86394

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: SENP7