Semaphorin 4G Recombinant Protein Antigen

Images

 
There are currently no images for Semaphorin 4G Protein (NBP1-82171PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Semaphorin 4G Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SEMA4G.

Source: E. coli

Amino Acid Sequence: ATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SEMA4G
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82171.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Semaphorin 4G Recombinant Protein Antigen

  • KIAA1619FLJ20590
  • MGC102867
  • sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, (semaphorin) 4G
  • SEMA4G
  • Semaphorin 4G
  • semaphorin-4G

Background

Semaphorins are a large family of conserved secreted and membrane associated proteins which possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Based on sequence and structural similarities, semaphorins are put into eight classes: invertebrates contain classes 1 and 2, viruses have class V, and vertebrates contain classes 3-7. Semaphorins serve as axon guidance ligands via multimeric receptor complexes, some (if not all) containing plexin proteins. This gene encodes a class 4 semaphorin. This gene and the gene for mitochondrial ribosomal protein L43 overlap at map location 10q24.31 and are transcribed in opposite directions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84310
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-13659
Species: Hu
Applications: ChIP, IHC,  IHC-P
AF5329
Species: Hu
Applications: IHC, KO, WB
NBP1-87372
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92275
Species: Hu
Applications: IHC,  IHC-P
485-MI
Species: Mu
Applications: BA
NBP2-49142
Species: Hu
Applications: IHC,  IHC-P, KD, WB
AF5235
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
AF5486
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
AF4309
Species: Hu, Mu
Applications: ICC, IHC, WB
AF3235
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-92754
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-82580
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
3237-S3
Species: Mu
Applications: BA
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-82171PEP
Species: Hu
Applications: AC

Publications for Semaphorin 4G Protein (NBP1-82171PEP) (0)

There are no publications for Semaphorin 4G Protein (NBP1-82171PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 4G Protein (NBP1-82171PEP) (0)

There are no reviews for Semaphorin 4G Protein (NBP1-82171PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Semaphorin 4G Protein (NBP1-82171PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Semaphorin 4G Products

Research Areas for Semaphorin 4G Protein (NBP1-82171PEP)

Find related products by research area.

Blogs on Semaphorin 4G

There are no specific blogs for Semaphorin 4G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Semaphorin 4G Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA4G