Semaphorin 3E Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Semaphorin 3E Antibody [NBP1-84408] - Staining of mouse midbrain shows strong immunoreactivity in the dorsal raphe neurons.
Immunohistochemistry-Paraffin: Semaphorin 3E Antibody [NBP1-84408] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neurons.
Immunocytochemistry/ Immunofluorescence: Semaphorin 3E Antibody [NBP1-84408] - Staining of mouse hypothalamus shows postivity in a subset of neurons in the anterior hypothalamic area.
Immunocytochemistry/ Immunofluorescence: Semaphorin 3E Antibody [NBP1-84408] - Staining of mouse caudate putamen shows cytoplasmic immunoreactivity in neurons.
Immunocytochemistry/ Immunofluorescence: Semaphorin 3E Antibody [NBP1-84408] - Staining of mouse hippocampus shows cytoplasmic positivity in the CA2 pyramidal neurons.
Immunocytochemistry/ Immunofluorescence: Semaphorin 3E Antibody [NBP1-84408] - Staining of mouse visual cortex shows cytoplasmic immunoreactivity in neurons.
Immunohistochemistry-Paraffin: Semaphorin 3E Antibody [NBP1-84408] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Semaphorin 3E Antibody [NBP1-84408] - Staining of human cerebral cortex shows staining in blood vessels and moderate positivity in neurons.
Immunohistochemistry-Paraffin: Semaphorin 3E Antibody [NBP1-84408] - Staining of human hippocampus shows positivity in blood vessels and neurons.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Semaphorin 3E Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MDLGLLFLRLHKSDAGTYFCQTVEHSFVHTVRKITLEVVEEEKVEDMFNKDDEEDRHHRMPCPAQSSISQGAKPWYKEFLQLIGYSNFQRVEEYCEKVWCTDRKRKKLKMSPSKWKYANPQEKKLRSKPEHYR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEMA3E
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Semaphorin 3E Protein (NBP1-84408PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Semaphorin 3E Antibody

  • (semaphorin) 3E
  • coll-5
  • KIAA0331M-SEMAH
  • sema domain, immunoglobulin domain (Ig), short basic domain, secreted
  • Sema3E
  • SEMAH
  • SEMAHM-SemaK
  • Semaphorin 3E
  • semaphorin-3E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4160
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF567
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-85517
Species: Hu
Applications: IHC, IHC-P
NBP1-31551
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB1728
Species: Hu, Mu
Applications: WB, IHC, ICC
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF4075
Species: Mu, Rt
Applications: WB, IHC
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-83881
Species: Hu
Applications: IHC, IHC-P
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NBP1-81480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84408
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for Semaphorin 3E Antibody (NBP1-84408) (0)

There are no publications for Semaphorin 3E Antibody (NBP1-84408).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 3E Antibody (NBP1-84408) (0)

There are no reviews for Semaphorin 3E Antibody (NBP1-84408). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Semaphorin 3E Antibody (NBP1-84408) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Semaphorin 3E Products

Bioinformatics Tool for Semaphorin 3E Antibody (NBP1-84408)

Discover related pathways, diseases and genes to Semaphorin 3E Antibody (NBP1-84408). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semaphorin 3E Antibody (NBP1-84408)

Discover more about diseases related to Semaphorin 3E Antibody (NBP1-84408).
 

Pathways for Semaphorin 3E Antibody (NBP1-84408)

View related products by pathway.

PTMs for Semaphorin 3E Antibody (NBP1-84408)

Learn more about PTMs related to Semaphorin 3E Antibody (NBP1-84408).
 

Research Areas for Semaphorin 3E Antibody (NBP1-84408)

Find related products by research area.

Blogs on Semaphorin 3E

There are no specific blogs for Semaphorin 3E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Semaphorin 3E Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA3E
Entrez