Semaphorin 3C Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: PWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDTRQQHQQGDESQKMRGDYGKLKALINSRKSRNRRNQLPES |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SEMA3C |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1-4 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Semaphorin 3C Antibody
Background
SEMA3C - sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA, BA
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
Publications for Semaphorin 3C Antibody (NBP1-80768) (0)
There are no publications for Semaphorin 3C Antibody (NBP1-80768).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Semaphorin 3C Antibody (NBP1-80768) (0)
There are no reviews for Semaphorin 3C Antibody (NBP1-80768).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Semaphorin 3C Antibody (NBP1-80768) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Semaphorin 3C Products
Blogs on Semaphorin 3C