Semaphorin 3B Antibody - BSA Free

Western Blot: Semaphorin 3B Antibody [NBP2-86801] - Host: Rabbit. Target Name: SEMA3B. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Semaphorin 3B Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human Semaphorin 3B. Peptide sequence: FRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SEMA3B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Semaphorin 3B Antibody - BSA Free

• (semaphorin) 3B
• LUCA-1
• Sema A(V)
• sema domain, immunoglobulin domain (Ig), short basic domain, secreted
• Sema V
• SemA
• SEMA3B
• SEMA5
• SEMA5FLJ34863
• SEMAA
• Semaphorin 3B
• semaphorin A
• semaphorin V
• semaphorin-3B
• semaphorin-V
• SEMAV

Background

The semaphorin family of inhibitory axon guidance molecules includes secreted, transmembrane, and GPI anchored extracellular molecules. These proteins regulate axon guidance by inhibiting axons from growing toward incorrect targets. SEMA3B inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SEMA3B