Semaphorin 3B Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human Semaphorin 3B. Peptide sequence: FRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SEMA3B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Semaphorin 3B Antibody - BSA Free
Background
The semaphorin family of inhibitory axon guidance molecules includes secreted, transmembrane, and GPI anchored extracellular molecules. These proteins regulate axon guidance by inhibiting axons from growing toward incorrect targets. SEMA3B inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: ELISA
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Publications for Semaphorin 3B Antibody (NBP2-86801) (0)
There are no publications for Semaphorin 3B Antibody (NBP2-86801).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Semaphorin 3B Antibody (NBP2-86801) (0)
There are no reviews for Semaphorin 3B Antibody (NBP2-86801).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Semaphorin 3B Antibody (NBP2-86801) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Semaphorin 3B Products
Research Areas for Semaphorin 3B Antibody (NBP2-86801)
Find related products by research area.
|
Blogs on Semaphorin 3B