SELI Antibody

Images

 
Western Blot: SELI Antibody [H00085465-A01] - Analysis of SELI expression in HeLa (Cat # L013V1).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SELI Antibody Summary

Immunogen
SELI (NP_277040, 1 a.a. - 50 a.a.) partial recombinant protein with GST tag. MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAP
Specificity
SELI - selenoprotein I
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
EPT1
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Reviewed Applications
Read 1 Review rated 1
using
H00085465-A01 in the following applications:

Publications
Read Publications using
H00085465-A01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SELI Antibody

  • EC 2.7.8.1
  • ethanolaminephosphotransferase 1 (CDP-ethanolamine-specific)
  • hEPT1
  • KIAA1724ethanolaminephosphotransferase 1
  • Selenoprotein I
  • SelI
  • SELIethanolaminephosphotransferase1
  • SEPI

Background

This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92299
Species: Hu
Applications: WB
NB100-53791
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-85471
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009211-P01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
292-G2
Species: Hu
Applications: BA
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-33950
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
375-TL
Species: Hu
Applications: BA
H00083642-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF3628
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-41083
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
NBP3-25538
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00085465-A01
Species: Hu
Applications: WB, ELISA

Publications for SELI Antibody (H00085465-A01)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for SELI Antibody (H00085465-A01) (1) 11

Average Rating: 1
(Based on 1 review)
We have 1 review tested in 1 species: Human and Mouse.

Reviews using H00085465-A01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human and Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot SELI H00085465-A01
Enlarge
1
reviewed by:
Hua Jiang
WB Human and Mouse 04/19/2021
View

Summary

ApplicationWestern Blot
Sample Testedhela cell,human fibroblast cells and mouse liver tissue,Human liver,mouse liver and brain
SpeciesHuman and Mouse
LotL3301

Comments

CommentsIn sample types, I accidentally added in human fibroblast cell etc, but I don't know how to remove it. I didn't use these cells in my test.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SELI Antibody (H00085465-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

1
5
0
4
0
3
0
2
0
1
1

Hua Jiang
04/19/2021
Application: WB
Species: Human and Mouse

Bioinformatics

Gene Symbol EPT1
Entrez
OMIM
Uniprot