SELI Antibody - Azide and BSA Free

Western Blot: SELI Antibody [H00085465-A01] - Analysis of SELI expression in HeLa (Cat # L013V1).

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SELI Antibody - Azide and BSA Free Summary

• Immunogen: SELI (NP_277040, 1 a.a. - 50 a.a.) partial recombinant protein with GST tag. MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAP
• Specificity: SELI - selenoprotein I
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: EPT1
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: 50% Glycerol
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SELI Antibody - Azide and BSA Free

• EC 2.7.8.1
• ethanolaminephosphotransferase 1 (CDP-ethanolamine-specific)
• hEPT1
• KIAA1724ethanolaminephosphotransferase 1
• Selenoprotein I
• SelI
• SELIethanolaminephosphotransferase1
• SEPI

Background

This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SELI Antibody (H00085465-A01)(3)

Publications using H00085465-A01

• Li Z, Ferguson L, Deol KK et al. Ribosome stalling during selenoprotein translation exposes a ferroptosis vulnerability Nature chemical biology 2022-05-30 [PMID: 35637349] (WB, Human)
• L Song, Z Liu, HH Hu, Y Yang, TY Li, ZZ Lin, J Ye, J Chen, X Huang, DT Liu, J Zhou, Y Shi, H Zhao, C Xie, L Chen, E Song, SY Lin, SC Lin Proto-oncogene Src links lipogenesis via lipin-1 to breast cancer malignancy Nat Commun, 2020-11-17;11(1):5842. 2020-11-17 [PMID: 33203880]
• Schoenmakers E, Agostini M, Mitchell C et al. Mutations in the selenocysteine insertion sequence-binding protein 2 gene lead to a multisystem selenoprotein deficiency disorder in humans. Clin Invest 120(12):4220-35. 2010-12-01 [PMID: 21084748]

Review for SELI Antibody (H00085465-A01) (1)

Average Rating: 1

(Based on 1 review)

We have 1 review tested in 1 species: Human and Mouse.

reviewed by: Hua Jiang WB Human and Mouse 04/19/2021

Summary

• Application: Western Blot
• Sample Tested: hela cell,human fibroblast cells and mouse liver tissue,Human liver,mouse liver and brain
• Species: Human and Mouse
• Lot: L3301

Comments

• Comments: In sample types, I accidentally added in human fibroblast cell etc, but I don't know how to remove it. I didn't use these cells in my test.

Bioinformatics

• Gene Symbol: EPT1
• Entrez:
  • 85465(Human)
• OMIM:
  • 607915(Human)
• Uniprot:
  • NP_277040(Human)