Secernin-1 Antibody

Images

 
Western Blot: Secernin-1 Antibody [NBP1-87861] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-510
Immunocytochemistry/ Immunofluorescence: Secernin-1 Antibody [NBP1-87861] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Secernin-1 Antibody [NBP1-87861] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Western Blot: Secernin-1 Antibody [NBP1-87861] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Secernin-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VKLVPKTQSPCFGDDDPAKKEPRFQEKPDRRHELYKAHEWARAIIESDQEQGRKLRSTMLELEKQGLEAMEEILTSSEPLDPAEVGDLFYDCVD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCRN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Secernin-1 Protein (NBP1-87861PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Secernin-1 Antibody

  • KIAA0193SES1
  • secernin 1
  • secernin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84112
Species: Hu
Applications: WB, IHC, IHC-P
H00083667-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-85994
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89883
Species: Hu
Applications: WB, IHC, IHC-P
H00006301-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
MAB7075
Species: Hu
Applications: WB
NBP1-81664
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6466
Species: Hu
Applications: WB
NBP1-57739
Species: Hu
Applications: WB
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
NBP2-33807
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14215
Species: Hu
Applications: IHC, IHC-P
NBP1-86899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Secernin-1 Antibody (NBP1-87861) (0)

There are no publications for Secernin-1 Antibody (NBP1-87861).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Secernin-1 Antibody (NBP1-87861) (0)

There are no reviews for Secernin-1 Antibody (NBP1-87861). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Secernin-1 Antibody (NBP1-87861) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Secernin-1 Products

Bioinformatics Tool for Secernin-1 Antibody (NBP1-87861)

Discover related pathways, diseases and genes to Secernin-1 Antibody (NBP1-87861). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Secernin-1 Antibody (NBP1-87861)

Discover more about diseases related to Secernin-1 Antibody (NBP1-87861).
 

Pathways for Secernin-1 Antibody (NBP1-87861)

View related products by pathway.

PTMs for Secernin-1 Antibody (NBP1-87861)

Learn more about PTMs related to Secernin-1 Antibody (NBP1-87861).

Blogs on Secernin-1

There are no specific blogs for Secernin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Secernin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCRN1