FAM109B Antibody

Images

 
Western Blot: FAM109B Antibody [NBP1-84112] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17, Lane 2: Human cell line RT-4, Lane 3: Human cell line EFO-21
Immunohistochemistry-Paraffin: FAM109B Antibody [NBP1-84112] - Staining of human skin shows moderate cytoplasmic positivity mainly in keratinocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM109B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AWVKVLSRASFGYMRLVVRELESQLQDARQSLALQRRSSWKSVASRCKPQAPNHRAAGLENGHCLSKDSSPVGLVEEAGSRSAGWGLAEWELQGPASLLLGKGQSPVSPETSCFSTLHDWYGQEIVELRQCWQKRAQGSHSKCEEQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM109B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM109B Protein (NBP1-84112PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM109B Antibody

  • 27 kDa inositol polyphosphate phosphatase interacting protein B
  • DKFZp686J07229
  • family with sequence similarity 109, member B
  • hypothetical protein LOC150368
  • IPIP27B
  • MGC125831
  • MGC125832
  • Ses2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57739
Species: Hu
Applications: WB
NBP2-19621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-45727
Species: Hu, Rt, Mk
Applications: WB, IHC
MAB7075
Species: Hu
Applications: WB
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89439
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P

Publications for FAM109B Antibody (NBP1-84112) (0)

There are no publications for FAM109B Antibody (NBP1-84112).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM109B Antibody (NBP1-84112) (0)

There are no reviews for FAM109B Antibody (NBP1-84112). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM109B Antibody (NBP1-84112) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM109B Products

Bioinformatics Tool for FAM109B Antibody (NBP1-84112)

Discover related pathways, diseases and genes to FAM109B Antibody (NBP1-84112). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM109B Antibody (NBP1-84112)

Discover more about diseases related to FAM109B Antibody (NBP1-84112).
 

Pathways for FAM109B Antibody (NBP1-84112)

View related products by pathway.

Blogs on FAM109B

There are no specific blogs for FAM109B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM109B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM109B