SEC62 Antibody

Images

 
Immunohistochemistry: SEC62 Antibody [NBP2-38920] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells, glial cells and endothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEC62 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKK
Specificity
Specificity of human SEC62 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEC62
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SEC62 Protein (NBP2-38920PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEC62 Antibody

  • Dtrp1
  • hTP-1
  • S.cerevisiae, homolog of
  • SEC62 homolog (S. cerevisiae)
  • TLOC1
  • TP-1
  • translocation protein 1
  • translocation protein SEC62

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31267
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30405
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
AF1543
Species: Hu
Applications: WB, IHC
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-07755
Species: Hu
NB120-2938
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF3848
Species: Hu
Applications: WB, IHC, IP
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77285
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for SEC62 Antibody (NBP2-38920) (0)

There are no publications for SEC62 Antibody (NBP2-38920).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC62 Antibody (NBP2-38920) (0)

There are no reviews for SEC62 Antibody (NBP2-38920). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SEC62 Antibody (NBP2-38920) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SEC62 Antibody (NBP2-38920)

Discover related pathways, diseases and genes to SEC62 Antibody (NBP2-38920). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC62 Antibody (NBP2-38920)

Discover more about diseases related to SEC62 Antibody (NBP2-38920).
 

Pathways for SEC62 Antibody (NBP2-38920)

View related products by pathway.

PTMs for SEC62 Antibody (NBP2-38920)

Learn more about PTMs related to SEC62 Antibody (NBP2-38920).

Blogs on SEC62

There are no specific blogs for SEC62, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEC62 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC62
Uniprot