SEC3 Antibody - BSA Free Summary
Description |
Novus Biologicals Rabbit SEC3 Antibody - BSA Free (NBP2-55234) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CISNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVNVEKVANESQKTPRDVVMMENFH |
Predicted Species |
Mouse (99%), Rat (98%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
EXOC1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for SEC3 Antibody - BSA Free
Background
The EXOC1 (also known as SEC3) gene encodes an exocyst complex component 1 protein, that in isoform 1 is 894 amino acids long and nearly 102 kDA and in isoform 2 is 879 amino acids long and 100 kDA. The EXOC1 gene functions in the docking of exocytic vesicles with fusion sites on the plasma membrane. EXOC1 participates in the insulin pathway, Arf6 trafficking events, exocyst complex formation, and the metabolism of proteins through interacts with genes EXOC4, PKP3, LUC7L2, CDC5L, and C7orf55-LUC7L2. EXOC1 has been linked to toxic shock syndrome, schizophrenia, and mucopolysaccharidosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Ch, Fi, Gp, Ha, Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Ch, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Ye
Applications: IB, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for SEC3 Antibody (NBP2-55234) (0)
There are no publications for SEC3 Antibody (NBP2-55234).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SEC3 Antibody (NBP2-55234) (0)
There are no reviews for SEC3 Antibody (NBP2-55234).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SEC3 Antibody (NBP2-55234) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SEC3 Products
Research Areas for SEC3 Antibody (NBP2-55234)
Find related products by research area.
|
Blogs on SEC3