EXOC6 Antibody

Images

 
Western Blot: EXOC6 Antibody [NBP1-85031] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: EXOC6 Antibody [NBP1-85031] - Staining of human cell line U-2 OS shows positivity in cytoplasm, vesicles and centrosome.
Immunohistochemistry-Paraffin: EXOC6 Antibody [NBP1-85031] - Staining of human adrenal gland shows strong membranous and cytoplasmic positivity in cortical cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EXOC6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EXOC6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EXOC6 Protein (NBP1-85031PEP)
Publications
Read Publication using
NBP1-85031 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EXOC6 Antibody

  • DKFZp761I2124
  • EXOC6A
  • exocyst complex component 6
  • Exocyst complex component Sec15A
  • FLJ1125
  • FLJ11251
  • MGC33397
  • SEC15A
  • SEC15L1SEC15-like 1 (S. cerevisiae)
  • SEC15L3
  • SEC15-like 1
  • SEC15-like protein 1
  • SEC15-like protein 3
  • SEC15LSEC15
  • Sec15p

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97492
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fi, GP, Ha, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-97500
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Ha, Mk, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-P
NBP1-89957
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31841
Species: Hu
Applications: IHC, IHC-P
NBP1-83786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-56692
Species: Hu
Applications: WB, ICC/IF
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85031
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EXOC6 Antibody (NBP1-85031)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for EXOC6 Antibody (NBP1-85031) (0)

There are no reviews for EXOC6 Antibody (NBP1-85031). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EXOC6 Antibody (NBP1-85031) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EXOC6 Products

Bioinformatics Tool for EXOC6 Antibody (NBP1-85031)

Discover related pathways, diseases and genes to EXOC6 Antibody (NBP1-85031). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EXOC6 Antibody (NBP1-85031)

Discover more about diseases related to EXOC6 Antibody (NBP1-85031).
 

Pathways for EXOC6 Antibody (NBP1-85031)

View related products by pathway.

Blogs on EXOC6

There are no specific blogs for EXOC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EXOC6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOC6