SEC14L2 Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

SEC14L2 Recombinant Protein Summary

Description
SEC14L2 (Human) GST-Tagged Recombinant Protein (P01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGICKYLCLGNALKPHVQLSACEVPLPPWIFGSEC
Preparation
Method
in vitro wheat germ expression system
Gene
SEC14L2

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SEC14L2 Recombinant Protein

  • C22orf6
  • hTAP
  • KIAA1186SEC14 (S. cerevisiae)-like 2
  • KIAA1658SPFAlpha-tocopherol-associated protein
  • SEC14-like 2 (S. cerevisiae)
  • SEC14-like protein 2
  • Squalene transfer protein
  • Supernatant protein factor
  • TAP1
  • TAPMGC65053
  • tocopherol-associated protein

Background

This gene encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54436
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-IC
NBP1-59071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, InhibTFunc
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00005696-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00023541-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SEC14L2 Recombinant Protein (H00023541-P01) (0)

There are no publications for SEC14L2 Recombinant Protein (H00023541-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC14L2 Recombinant Protein (H00023541-P01) (0)

There are no reviews for SEC14L2 Recombinant Protein (H00023541-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SEC14L2 Recombinant Protein (H00023541-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SEC14L2 Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for SEC14L2 Recombinant Protein (H00023541-P01)

Discover related pathways, diseases and genes to SEC14L2 Recombinant Protein (H00023541-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC14L2 Recombinant Protein (H00023541-P01)

Discover more about diseases related to SEC14L2 Recombinant Protein (H00023541-P01).
 

Pathways for SEC14L2 Recombinant Protein (H00023541-P01)

View related products by pathway.

PTMs for SEC14L2 Recombinant Protein (H00023541-P01)

Learn more about PTMs related to SEC14L2 Recombinant Protein (H00023541-P01).
 

Research Areas for SEC14L2 Recombinant Protein (H00023541-P01)

Find related products by research area.

Blogs on SEC14L2

There are no specific blogs for SEC14L2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SEC14L2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00023541-P01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought