Recombinant Human SEC14L2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SEC14L2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 101-199 of Human SEC14L2

Source: Wheat Germ

Amino Acid Sequence: DIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFP

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SEC14L2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SEC14L2 Protein

  • C22orf6
  • hTAP
  • KIAA1186SEC14 (S. cerevisiae)-like 2
  • KIAA1658SPFAlpha-tocopherol-associated protein
  • SEC14-like 2 (S. cerevisiae)
  • SEC14-like protein 2
  • Squalene transfer protein
  • Supernatant protein factor
  • TAP1
  • TAPMGC65053
  • tocopherol-associated protein

Background

This gene encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NB120-6405
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP1-59071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-75554
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, ICC/IF, IHC, IHC-P, IP, PA, B/N
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57160
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, IHC-P (-)
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00023541-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SEC14L2 Partial Recombinant Protein (H00023541-Q01) (0)

There are no publications for SEC14L2 Partial Recombinant Protein (H00023541-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC14L2 Partial Recombinant Protein (H00023541-Q01) (0)

There are no reviews for SEC14L2 Partial Recombinant Protein (H00023541-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SEC14L2 Partial Recombinant Protein (H00023541-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SEC14L2 Partial Recombinant Protein (H00023541-Q01)

Discover related pathways, diseases and genes to SEC14L2 Partial Recombinant Protein (H00023541-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC14L2 Partial Recombinant Protein (H00023541-Q01)

Discover more about diseases related to SEC14L2 Partial Recombinant Protein (H00023541-Q01).
 

Pathways for SEC14L2 Partial Recombinant Protein (H00023541-Q01)

View related products by pathway.

PTMs for SEC14L2 Partial Recombinant Protein (H00023541-Q01)

Learn more about PTMs related to SEC14L2 Partial Recombinant Protein (H00023541-Q01).
 

Research Areas for SEC14L2 Partial Recombinant Protein (H00023541-Q01)

Find related products by research area.

Blogs on SEC14L2

There are no specific blogs for SEC14L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SEC14L2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC14L2