SDF4 Antibody


Western Blot: SDF4 Antibody [NBP1-69311] - This Anti-SDF4 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 2.5ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SDF4 Antibody Summary

Synthetic peptides corresponding to SDF4(stromal cell derived factor 4) The peptide sequence was selected from the C terminal of SDF4. Peptide sequence KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SDF4 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
SDF4 Lysate (NBP2-65947)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SDF4 Antibody

  • 45 kDa calcium-binding protein
  • CAB45
  • Cab45Stromal cell-derived factor 4
  • calcium binding protein
  • SDF-4
  • stromal cell derived factor 4


SDF4 may regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Mu
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for SDF4 Antibody (NBP1-69311) (0)

There are no publications for SDF4 Antibody (NBP1-69311).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SDF4 Antibody (NBP1-69311) (0)

There are no reviews for SDF4 Antibody (NBP1-69311). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SDF4 Antibody (NBP1-69311) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional SDF4 Products

Bioinformatics Tool for SDF4 Antibody (NBP1-69311)

Discover related pathways, diseases and genes to SDF4 Antibody (NBP1-69311). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SDF4 Antibody (NBP1-69311)

Discover more about diseases related to SDF4 Antibody (NBP1-69311).

Pathways for SDF4 Antibody (NBP1-69311)

View related products by pathway.

Blogs on SDF4

There are no specific blogs for SDF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SDF4 Antibody and receive a gift card or discount.


Gene Symbol SDF4