SCP2/SYCP2 Recombinant Protein Antigen

Images

 
There are currently no images for SCP2/SYCP2 Recombinant Protein Antigen (NBP2-56608PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SCP2/SYCP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCP2.

Source: E.coli

Amino Acid Sequence: GERRANLLPKKLCKIEDADHHIHKMSESVSSLSTNDFSIPWETWQNEFAGIEMTYETYERLNSEFKRRNNIRHKMLSYFTTQSWKTAQQHLRTMNHQSQDSRI

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SYCP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-56608 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SCP2/SYCP2 Recombinant Protein Antigen

  • NLTP
  • non-specific lipid-transfer protein
  • NSL-TP
  • Propanoyl-CoA C-acyltransferase
  • SCP-2
  • SCP-CHI
  • SCPX
  • SCP-X
  • Sterol Carrier Protein 2
  • Sterol carrier protein X

Background

Chimera RNA interference (chimera RNAi) is process by which small interfering RNA/DNA chimera triggers the destruction of mRNA for the original gene. The discovery work, design, and application of chimera RNAi has been pioneered by Professor Kaoru Saigo and Dr. Kumiko Ui-Tei at the University of Tokyo. Chimera RNAi has many advantages over the conventional siRNAs. First, it has been demonstrated to have reliable knock-down for over 10,000 human genes. Because the human genome is composed of an intricate, genetic network, chimera RNAi's unique design has successfully obviated the off-target effects including microRNA-based influence. Another advantage of the chimera RNAi technology is its effectiveness at low concentrations (0.5nM to 5nM); only mRNA is destroyed so genomic genes are not affected. Finally, having both the sense and anti-sense strands consisting RNA/DNA chimera, it offers much greater compound stability for streamlining in vitro and in vivo assays and applications while minimizing interferon induction and other adverse reactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-232
Species: Hu, Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87695
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF3166
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-31913
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03456
Species: Hu
Applications: WB, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80732
Species: Hu
Applications: IHC, IHC-P
NBP2-65250
Species: Hu
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-207
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-83387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86993
Species: Hu
Applications: WB, IHC, IHC-P
AF1476
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-56608PEP
Species: Hu
Applications: AC

Publications for SCP2/SYCP2 Recombinant Protein Antigen (NBP2-56608PEP) (0)

There are no publications for SCP2/SYCP2 Recombinant Protein Antigen (NBP2-56608PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCP2/SYCP2 Recombinant Protein Antigen (NBP2-56608PEP) (0)

There are no reviews for SCP2/SYCP2 Recombinant Protein Antigen (NBP2-56608PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for SCP2/SYCP2 Recombinant Protein Antigen (NBP2-56608PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SCP2/SYCP2 Recombinant Protein Antigen (NBP2-56608PEP)

Discover related pathways, diseases and genes to SCP2/SYCP2 Recombinant Protein Antigen (NBP2-56608PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCP2/SYCP2 Recombinant Protein Antigen (NBP2-56608PEP)

Discover more about diseases related to SCP2/SYCP2 Recombinant Protein Antigen (NBP2-56608PEP).
 

Pathways for SCP2/SYCP2 Recombinant Protein Antigen (NBP2-56608PEP)

View related products by pathway.

PTMs for SCP2/SYCP2 Recombinant Protein Antigen (NBP2-56608PEP)

Learn more about PTMs related to SCP2/SYCP2 Recombinant Protein Antigen (NBP2-56608PEP).

Blogs on SCP2/SYCP2

There are no specific blogs for SCP2/SYCP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SCP1 Antibody
NB300-229

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SCP2/SYCP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SYCP2