SCO1 Antibody

Images

 
Western Blot: SCO1 Antibody [NBP1-87074] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-505
Immunohistochemistry-Paraffin: SCO1 Antibody [NBP1-87074] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCO1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SCO1 Protein (NBP1-87074PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCO1 Antibody

  • protein SCO1 homolog, mitochondrial
  • SCO cytochrome oxidase deficient homolog 1 (yeast)
  • SCOD1SCO (cytochrome oxidase deficient, yeast) homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77274
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-30388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
H00001353-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-86322
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006834-T01
Species: Hu
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-88677
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009973-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP1-59560
Species: Hu
Applications: WB, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87074
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SCO1 Antibody (NBP1-87074) (0)

There are no publications for SCO1 Antibody (NBP1-87074).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCO1 Antibody (NBP1-87074) (0)

There are no reviews for SCO1 Antibody (NBP1-87074). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCO1 Antibody (NBP1-87074) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCO1 Products

Bioinformatics Tool for SCO1 Antibody (NBP1-87074)

Discover related pathways, diseases and genes to SCO1 Antibody (NBP1-87074). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCO1 Antibody (NBP1-87074)

Discover more about diseases related to SCO1 Antibody (NBP1-87074).
 

Pathways for SCO1 Antibody (NBP1-87074)

View related products by pathway.

PTMs for SCO1 Antibody (NBP1-87074)

Learn more about PTMs related to SCO1 Antibody (NBP1-87074).

Blogs on SCO1

There are no specific blogs for SCO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCO1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCO1