SCIN Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SCIN Antibody [NBP1-89229] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: SCIN Antibody [NBP1-89229] - Staining of human kidney shows strong cytoplasmic and membranous positivity in a subset of tubules.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCIN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RNLASITRIVEVDVDANSLNSNDVFVLKLPQNSGYIWVGKGASQEEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQTSPLLETQAEDHPPRLYGCSNK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCIN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SCIN Protein (NBP1-89229PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCIN Antibody

  • KIAA1905adseverin
  • Scinderin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-34118
Species: Hu
Applications: IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-31733
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
1705-HH/CF
Species: Hu, Mu
NBP1-90363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
409-ML/CF
Species: Mu
NBP1-88026
Species: Hu
Applications: IHC, IHC-P
NBP2-45889
Species: Hu
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00064151-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NB120-11867
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-P
NBP1-89229
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SCIN Antibody (NBP1-89229) (0)

There are no publications for SCIN Antibody (NBP1-89229).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCIN Antibody (NBP1-89229) (0)

There are no reviews for SCIN Antibody (NBP1-89229). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SCIN Antibody (NBP1-89229) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCIN Products

Bioinformatics Tool for SCIN Antibody (NBP1-89229)

Discover related pathways, diseases and genes to SCIN Antibody (NBP1-89229). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCIN Antibody (NBP1-89229)

Discover more about diseases related to SCIN Antibody (NBP1-89229).
 

Pathways for SCIN Antibody (NBP1-89229)

View related products by pathway.

PTMs for SCIN Antibody (NBP1-89229)

Learn more about PTMs related to SCIN Antibody (NBP1-89229).
 

Research Areas for SCIN Antibody (NBP1-89229)

Find related products by research area.

Blogs on SCIN

There are no specific blogs for SCIN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCIN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCIN