SCCPDH Antibody

Images

 
Western Blot: SCCPDH Antibody [NBP2-13287] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: SCCPDH Antibody [NBP2-13287] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: SCCPDH Antibody [NBP2-13287] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCCPDH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YGEPVIKACIENGASCIDISGEPQFLELMQLKYHEKAADKGVYIIGSSGF DSIPADLGVIYTRNKMNGTLTAVESFLTIHSGPEGLSIHDGTWKSAIYGF GDQSNLRKLRNVSNLKPVPLIGPKLK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCCPDH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.In Simple Western only 10-15 uL of the recommended dilution is used per data point.
Control Peptide
SCCPDH Protein (NBP2-13287PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCCPDH Antibody

  • CGI-49
  • EC 1.5.1.9
  • FLJ43187
  • NET11
  • probable saccharopine dehydrogenase
  • RP11-439E19.2
  • saccharopine dehydrogenase (putative)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13468
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40764
Species: Hu, Mu, Po, Pm
Applications: WB, ICC/IF
H00030845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-33283
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-430
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-87283
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01294
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-58362
Species: Hu
Applications: ICC/IF
H00002181-B01P
Species: Hu
Applications: WB, ICC/IF
NB110-41576
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP2-13776
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82474
Species: Hu
Applications: WB, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP1-49536
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P

Publications for SCCPDH Antibody (NBP2-13287) (0)

There are no publications for SCCPDH Antibody (NBP2-13287).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCCPDH Antibody (NBP2-13287) (0)

There are no reviews for SCCPDH Antibody (NBP2-13287). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SCCPDH Antibody (NBP2-13287) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCCPDH Products

Bioinformatics Tool for SCCPDH Antibody (NBP2-13287)

Discover related pathways, diseases and genes to SCCPDH Antibody (NBP2-13287). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SCCPDH

There are no specific blogs for SCCPDH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCCPDH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCCPDH