SCARA5 Antibody - BSA Free

Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.

Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SCARA5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SCARA5 Antibody - BSA Free (NBP1-83572) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PDDLKALTRNVNRLNESFRDLQLRLLQAPLQADLTEQVWKVQDALQNQSDSLLALAGAVQRLE
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCARA5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SCARA5 Protein (NBP1-83572PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SCARA5 Antibody - BSA Free

• FLJ23907
• MGC45780
• SCARA5
• scavenger receptor class A, member 5 (putative)
• Tesr
• testis expressed scavenger receptor
• UNQ2938/PRO28700

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCARA5