SCARA3 Antibody

Images

 
Western Blot: SCARA3 Antibody [NBP1-79201] - Mouse Brain Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity Mu, Hu, Rt, Po, Bv, Ca, Eq, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCARA3 Antibody Summary

Immunogen
The immunogen for this antibody is Scara3. Peptide sequence KTIQTTLGASSQRISQNSESMHDLVLQVMGLQLQLDNISSFLDDHEENMH. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Rat (100%), Porcine (100%), Rabbit (100%), Bovine (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCARA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against Scara3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SCARA3 Antibody

  • APC7
  • CSR
  • CSR1
  • CSRCellular stress response gene protein
  • macrophage scavenger receptor-like 1
  • MSLR1cellular stress response protein
  • MSRL1
  • SCARA3
  • scavenger receptor class A member 3
  • scavenger receptor class A, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-82073
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
6507-IL/CF
Species: Hu
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31209
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86125
Species: Hu
Applications: IHC, IHC-P
NB100-56516
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56183
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SCARA3 Antibody (NBP1-79201) (0)

There are no publications for SCARA3 Antibody (NBP1-79201).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCARA3 Antibody (NBP1-79201) (0)

There are no reviews for SCARA3 Antibody (NBP1-79201). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCARA3 Antibody (NBP1-79201) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SCARA3 Products

Bioinformatics Tool for SCARA3 Antibody (NBP1-79201)

Discover related pathways, diseases and genes to SCARA3 Antibody (NBP1-79201). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCARA3 Antibody (NBP1-79201)

Discover more about diseases related to SCARA3 Antibody (NBP1-79201).
 

Pathways for SCARA3 Antibody (NBP1-79201)

View related products by pathway.

PTMs for SCARA3 Antibody (NBP1-79201)

Learn more about PTMs related to SCARA3 Antibody (NBP1-79201).

Blogs on SCARA3

There are no specific blogs for SCARA3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCARA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCARA3
Uniprot