SCAMP3 Antibody

Images

 
Western Blot: SCAMP3 Antibody [NBP2-56966] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: SCAMP3 Antibody [NBP2-56966] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCAMP3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEP
Specificity
Specificity of human SCAMP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCAMP3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SCAMP3 Recombinant Protein Antigen (NBP2-56966PEP)

Reactivity Notes

Mouse 87%, Rat 86%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SCAMP3 Antibody

  • propin 1
  • PROPIN1
  • SCAMP3
  • secretory carrier membrane protein 3C1orf3
  • secretory carrier-associated membrane protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-80520
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP1-81761
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-03536
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-47506
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002629-M01
Species: Hu, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-45688
Species: Hu
Applications: WB, IHC
NBP1-88343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-595
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
H00009146-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, RNAi, S-ELISA
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-85131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-69285
Species: Hu
Applications: WB

Publications for SCAMP3 Antibody (NBP2-56966) (0)

There are no publications for SCAMP3 Antibody (NBP2-56966).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCAMP3 Antibody (NBP2-56966) (0)

There are no reviews for SCAMP3 Antibody (NBP2-56966). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SCAMP3 Antibody (NBP2-56966) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SCAMP3 Products

Bioinformatics Tool for SCAMP3 Antibody (NBP2-56966)

Discover related pathways, diseases and genes to SCAMP3 Antibody (NBP2-56966). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCAMP3 Antibody (NBP2-56966)

Discover more about diseases related to SCAMP3 Antibody (NBP2-56966).
 

Pathways for SCAMP3 Antibody (NBP2-56966)

View related products by pathway.

PTMs for SCAMP3 Antibody (NBP2-56966)

Learn more about PTMs related to SCAMP3 Antibody (NBP2-56966).

Blogs on SCAMP3

There are no specific blogs for SCAMP3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCAMP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCAMP3