GPATCH4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GPATCH4 Antibody [NBP1-85131] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: GPATCH4 Antibody [NBP1-85131] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPATCH4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TASERNDADEKHPEHAEQNIRKSKKKKRRHQEGKVSDEREGTTKGNEKEDAAGTSGLGELNSREQTNQSLRKGKKKKRWHHEEEKMGVLEEGGKGKEAAGSVRT
Specificity
Specificity of human GPATCH4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPATCH4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPATCH4 Antibody

  • G patch domain containing 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93674
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-93290
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-89169
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB3616
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-30626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF5344
Species: Hu, Mu
Applications: WB
NBP1-91476
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, Simple Western
NB600-600
Species: Hu, Mu, Ca
Applications: WB, ChIP, ELISA, Flow, IB, IHC, IHC-P, Flow-IC
NBP1-89355
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-57016
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB
H00128239-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-71662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-55356
Species: Hu
Applications: IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for GPATCH4 Antibody (NBP1-85131) (0)

There are no publications for GPATCH4 Antibody (NBP1-85131).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPATCH4 Antibody (NBP1-85131) (0)

There are no reviews for GPATCH4 Antibody (NBP1-85131). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GPATCH4 Antibody (NBP1-85131) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GPATCH4 Products

Bioinformatics Tool for GPATCH4 Antibody (NBP1-85131)

Discover related pathways, diseases and genes to GPATCH4 Antibody (NBP1-85131). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPATCH4 Antibody (NBP1-85131)

Discover more about diseases related to GPATCH4 Antibody (NBP1-85131).
 

Pathways for GPATCH4 Antibody (NBP1-85131)

View related products by pathway.

Blogs on GPATCH4

There are no specific blogs for GPATCH4, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPATCH4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPATCH4